KEGG   Homo sapiens (human): 196294
Entry
196294            CDS       T01001                                 

Gene name
IMMP1L, IMMP1, IMP1, IMP1-LIKE
Definition
(RefSeq) inner mitochondrial membrane peptidase subunit 1
  KO
K09647  mitochondrial inner membrane protease subunit 1 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    196294 (IMMP1L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    196294 (IMMP1L)
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    196294 (IMMP1L)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     196294 (IMMP1L)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S26: signal peptidase I family
   196294 (IMMP1L)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Other inner membrane factors
    196294 (IMMP1L)
SSDB
Motif
Pfam: Peptidase_S26 Peptidase_S24
Other DBs
NCBI-GeneID: 196294
NCBI-ProteinID: NP_001291203
OMIM: 612323
HGNC: 26317
Ensembl: ENSG00000148950
Vega: OTTHUMG00000166226
Pharos: Q96LU5(Tdark)
UniProt: Q96LU5
LinkDB
Position
11p13
AA seq 166 aa
MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHF
YGIQRGDIVIAKSPSDPKSNICKRVIGLEGDKILTTSPSDFFKSHSYVPMGHVWLEGDNL
QNSTDSRCYGPIPYGLIRGRIFFKIWPLSDFGFLRASPNGHRFSDD
NT seq 501 nt   +upstreamnt  +downstreamnt
atgcttcgtggtgttctggggaaaacctttcgacttgttggctatactattcaatatggc
tgtatagctcattgtgcttttgaatacgttggtggtgttgtcatgtgttctggaccatca
atggagcctacaattcaaaattcagatattgtctttgcagaaaatcttagtcgacatttt
tatggtatccaaagaggtgacattgtgattgcaaaaagcccaagtgatccaaaatcaaat
atttgtaaaagagtaattggtttggaaggagacaaaatcctcaccactagtccatcagat
ttctttaaaagccatagttatgtgccaatgggtcatgtttggttagaaggtgacaatcta
cagaattctacagattccaggtgctatggacctattccatatggactaataagaggacga
atcttctttaagatttggcctctgagtgattttggatttttacgtgccagccctaatggc
cacagattttctgatgattag

DBGET integrated database retrieval system