KEGG   Homo sapiens (human): 1981
Entry
1981              CDS       T01001                                 
Symbol
EIF4G1, EIF-4G1, EIF4F, EIF4G, EIF4GI, P220, PARK18
Name
(RefSeq) eukaryotic translation initiation factor 4 gamma 1
  KO
K03260  translation initiation factor 4G
Organism
hsa  Homo sapiens (human)
Pathway
hsa05416  Viral myocarditis
Disease
H00057  Parkinson disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    1981 (EIF4G1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    1981 (EIF4G1)
   03012 Translation factors [BR:hsa03012]
    1981 (EIF4G1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     1981 (EIF4G1)
   mRNA cycle factors
    Stress granule specific factors
     1981 (EIF4G1)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    1981 (EIF4G1)
SSDB
Motif
Pfam: MIF4G MA3 W2
Other DBs
NCBI-GeneID: 1981
NCBI-ProteinID: NP_937884
OMIM: 600495
HGNC: 3296
Ensembl: ENSG00000114867
Pharos: Q04637(Tbio)
UniProt: Q04637 Q96I65
Structure
LinkDB
Position
3:184314606..184335358
AA seq 1599 aa
MNKAPQSTGPPPAPSPGLPQPAFPPGQTAPVVFSTPQATQMNTPSQPRQHFYPSRAQPPS
SAASRVQSAAPARPGPAAHVYPAGSQVMMIPSQISYPASQGAYYIPGQGRSTYVVPTQQY
PVQPGAPGFYPGASPTEFGTYAGAYYPAQGVQQFPTGVAPTPVLMNQPPQIAPKRERKTI
RIRDPNQGGKDITEEIMSGARTASTPTPPQTGGGLEPQANGETPQVAVIVRPDDRSQGAI
IADRPGLPGPEHSPSESQPSSPSPTPSPSPVLEPGSEPNLAVLSIPGDTMTTIQMSVEES
TPISRETGEPYRLSPEPTPLAEPILEVEVTLSKPVPESEFSSSPLQAPTPLASHTVEIHE
PNGMVPSEDLEPEVESSPELAPPPACPSESPVPIAPTAQPEELLNGAPSPPAVDLSPVSE
PEEQAKEVTASMAPPTIPSATPATAPSATSPAQEEEMEEEEEEEEGEAGEAGEAESEKGG
EELLPPESTPIPANLSQNLEAAAATQVAVSVPKRRRKIKELNKKEAVGDLLDAFKEANPA
VPEVENQPPAGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQ
WKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANKTPLRPLDPTRLQGI
NCGPDFTPSFANLGRTTLSTRGPPRGGPGGELPRGPAGLGPRRSQQGPRKEPRKIIATVL
MTEDIKLNKAEKAWKPSSKRTAADKDRGEEDADGSKTQDLFRRVRSILNKLTPQMFQQLM
KQVTQLAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMALKVPTTEKPTVTVNFR
KLLLNRCQKEFEKDKDDDEVFEKKQKEMDEAATAEERGRLKEELEEARDIARRRSLGNIK
FIGELFKLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFN
QMEKIIKEKKTSSRIRFMLQDVLDLRGSNWVPRRGDQGPKTIDQIHKEAEMEEHREHIKV
QQLMAKGSDKRRGGPPGPPISRGLPLVDDGGWNTVPISKGSRPIDTSRLTKITKPGSIDS
NNQLFAPGGRLSWGKGSSGGSGAKPSDAASEAARPATSTLNRFSALQQAVPTESTDNRRV
VQRSSLSRERGEKAGDRGDRLERSERGGDRGDRLDRARTPATKRSFSKEVEERSRERPSQ
PEGLRKAASLTEDRDRGRDAVKREAALPPVSPLKAALSEEELEKKSKAIIEEYLHLNDMK
EAVQCVQELASPSLLFIFVRHGVESTLERSAIAREHMGQLLHQLLCAGHLSTAQYYQGLY
EILELAEDMEIDIPHVWLYLAELVTPILQEGGVPMGELFREITKPLRPLGKAASLLLEIL
GLLCKSMGPKKVGTLWREAGLSWKEFLPEGQDIGAFVAEQKVEYTLGEESEAPGQRALPS
EELNRQLEKLLKEGSSNQRVFDWIEANLSEQQIVSNTLVRALMTAVCYSAIIFETPLRVD
VAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAF
YSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN
NT seq 4800 nt   +upstreamnt  +downstreamnt
atgaacaaagctccacagtccacaggccccccacccgccccatcccccggactcccacag
ccagcgtttcccccggggcagacagcgccggtggtgttcagtacgccacaagcgacacaa
atgaacacgccttctcagccccgccagcacttctaccctagccgggcccagcccccgagc
agtgcagcctcccgagtgcagagtgcagcccctgcccgccctggcccagctgcccatgtc
taccctgctggatcccaagtaatgatgatcccttcccagatctcctacccagcctcccag
ggggcctactacatccctggacaggggcgttccacatacgttgtcccgacacagcagtac
cctgtgcagccaggagccccaggcttctatccaggtgcaagccctacagaatttgggacc
tacgctggcgcctactatccagcccaaggggtgcagcagtttcccactggcgtggccccc
accccagttttgatgaaccagccaccccagattgctcccaagagggagcgtaagacgatc
cgaattcgagatccaaaccaaggaggaaaggatatcacagaggagatcatgtctggggcc
cgcactgcctccacacccacccctccccagacgggaggcggtctggagcctcaagctaat
ggggagacgccccaggttgctgtcattgtccggccagatgaccggtcacagggagcaatc
attgctgaccggccagggctgcctggcccagagcatagcccttcagaatcccagccttcg
tcgccttctccgaccccatcaccatccccagtcttggaaccggggtctgagcctaatctc
gcagtcctctctattcctggggacactatgacaactatacaaatgtctgtagaagaatca
acccccatctcccgtgaaactggggagccatatcgcctctctccagaacccactcctctc
gccgaacccatactggaagtagaagtgacacttagcaaaccggttccagaatctgagttt
tcttccagtcctctccaggctcccacccctttggcatctcacacagtggaaattcatgag
cctaatggcatggtcccatctgaagatctggaaccagaggtggagtcaagcccagagctt
gctcctcccccagcttgcccctccgaatcccctgtgcccattgctccaactgcccaacct
gaggaactgctcaacggagccccctcgccaccagctgtggacttaagcccagtcagtgag
ccagaggagcaggccaaggaggtgacagcatcaatggcgccccccaccatcccctctgct
actccagctacggctccttcagctacttccccagctcaggaggaggaaatggaagaagaa
gaagaagaggaagaaggagaagcaggagaagcaggagaagctgagagtgagaaaggagga
gaggaactgctccccccagagagtacccctattccagccaacttgtctcagaatttggag
gcagcagcagccactcaagtggcagtatctgtgccaaagaggagacggaaaattaaggag
ctaaataagaaggaggctgttggagaccttctggatgccttcaaggaggcgaacccggca
gtaccagaggtggaaaatcagcctcctgcaggcagcaatccaggcccagagtctgagggc
agtggtgtgcccccacgtcctgaggaagcagatgagacctgggactcaaaggaagacaaa
attcacaatgctgagaacatccagcccggggaacagaagtatgaatataagtcagatcag
tggaagcctctaaacctagaggagaaaaaacgttacgaccgtgagttcctgcttggtttt
cagttcatctttgccagtatgcagaagccagagggattgccacatatcagtgacgtggtg
ctggacaaggccaataaaacaccactgcggccactggatcccactagactacaaggcata
aattgtggcccagacttcactccatcctttgccaaccttggccggacaacccttagcacc
cgtgggcccccaaggggtgggccaggtggggagctgccccgtgggccggctggcctggga
ccccggcgctctcagcagggaccccgaaaagaaccacgcaagatcattgccacagtgtta
atgaccgaagatataaaactgaacaaagcagagaaagcctggaaacccagcagcaagcgg
acggcggctgataaggatcgaggggaagaagatgctgatggcagcaaaacccaggaccta
ttccgcagggtgcgctccatcctgaataaactgacaccccagatgttccagcagctgatg
aagcaagtgacgcagctggccatcgacaccgaggaacgcctcaaaggggtcattgacctc
atttttgagaaggccatttcagagcccaacttctctgtggcctatgccaacatgtgccgc
tgcctcatggcgctgaaagtgcccactacggaaaagccaacagtgactgtgaacttccga
aagctgttgttgaatcgatgtcagaaggagtttgagaaagacaaagatgatgatgaggtt
tttgagaagaagcaaaaagagatggatgaagctgctacggcagaggaacgaggacgcctg
aaggaagagctggaagaggctcgggacatagcccggcggcgctctttagggaatatcaag
tttattggagagttgttcaaactgaagatgttaacagaggcaataatgcatgactgtgtg
gtcaaactgcttaagaaccatgatgaagagtcccttgagtgcctttgtcgtctgctcacc
accattggcaaagacctggactttgaaaaagccaagccccgaatggatcagtatttcaac
cagatggaaaaaatcattaaagaaaagaagacgtcatcccgcatccgctttatgctgcag
gacgtgctggatctgcgagggagcaattgggtgccacgccgaggggatcagggtcccaag
accattgaccagatccataaggaggctgagatggaagaacatcgagagcacatcaaagtg
cagcagctcatggccaagggcagtgacaagcgtcggggcggtcctccaggccctcccatc
agccgtggacttccccttgtggatgatggtggctggaacacagttcccatcagcaaaggt
agccgccccattgacacctcacgactcaccaagatcaccaagcctggctccatcgattct
aacaaccagctctttgcacctggagggcgactgagctggggcaagggcagcagcggaggc
tcaggagccaagccctcagacgcagcatcagaagctgctcgcccagctactagtactttg
aatcgcttctcagcccttcaacaagcggtacccacagaaagcacagataatagacgtgtg
gtgcagaggagtagcttgagccgagaacgaggcgagaaagctggagaccgaggagaccgc
ctagagcggagtgaacggggaggggaccgtggggaccggcttgatcgtgcgcggacacct
gctaccaagcggagcttcagcaaggaagtggaggagcggagtagagaacggccctcccag
cctgaggggctgcgcaaggcagctagcctcacggaggatcgggaccgtgggcgggatgcc
gtgaagcgagaagctgccctacccccagtgagccccctgaaggcggctctctctgaggag
gagttagagaagaaatccaaggctatcattgaggaatatctccatctcaatgacatgaaa
gaggcagtccagtgcgtgcaggagctggcctcaccctccttgctcttcatctttgtacgg
catggtgtcgagtctacgctggagcgcagtgccattgctcgtgagcatatggggcagctg
ctgcaccagctgctctgtgctgggcatctgtctactgctcagtactaccaagggttgtat
gaaatcttggaattggctgaggacatggaaattgacatcccccacgtgtggctctaccta
gcggaactggtaacacccattctgcaggaaggtggggtgcccatgggggagctgttcagg
gagattacaaagcctctgagaccgttgggcaaagctgcttccctgttgctggagatcctg
ggcctcctgtgcaaaagcatgggtcctaaaaaggtggggacgctgtggcgagaagccggg
cttagctggaaggaatttctacctgaaggccaggacattggtgcattcgtcgctgaacag
aaggtggagtataccctgggagaggagtcggaagcccctggccagagggcactcccctcc
gaggagctgaacaggcagctggagaagctgctgaaggagggcagcagtaaccagcgggtg
ttcgactggatagaggccaacctgagtgagcagcagatagtatccaacacgttagttcga
gccctcatgacggctgtctgctattctgcaattatttttgagactcccctccgagtggac
gttgcagtgctgaaagcgcgagcgaagctgctgcagaaatacctgtgtgacgagcagaag
gagctacaggcgctctacgccctccaggcccttgtagtgaccttagaacagcctcccaac
ctgctgcggatgttctttgacgcactgtatgacgaggacgtggtgaaggaggatgccttc
tacagttgggagagtagcaaggaccccgctgagcagcagggcaagggtgtggcccttaaa
tctgtcacagccttcttcaagtggctccgtgaagcagaggaggagtctgaccacaactga

KEGG   Homo sapiens (human): 1982
Entry
1982              CDS       T01001                                 
Symbol
EIF4G2, AAG1, DAP5, NAT1, P97
Name
(RefSeq) eukaryotic translation initiation factor 4 gamma 2
  KO
K03260  translation initiation factor 4G
Organism
hsa  Homo sapiens (human)
Pathway
hsa05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    1982 (EIF4G2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    1982 (EIF4G2)
   03012 Translation factors [BR:hsa03012]
    1982 (EIF4G2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     1982 (EIF4G2)
   mRNA cycle factors
    Stress granule specific factors
     1982 (EIF4G2)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    1982 (EIF4G2)
SSDB
Motif
Pfam: MIF4G W2 MA3
Other DBs
NCBI-GeneID: 1982
NCBI-ProteinID: NP_001166176
OMIM: 602325
HGNC: 3297
Ensembl: ENSG00000110321
Pharos: P78344(Tbio)
UniProt: P78344 Q2TU89
Structure
LinkDB
Position
11:complement(10797046..10808926)
AA seq 907 aa
MESAIAEGGASRFSASSGGGGSRGAPQHYPKTAGNSEFLGKTPGQNAQKWIPARSTRRDD
NSAANNSANEKERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILLIVD
KALEEPKYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTR
NVDVYDKRENPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKK
RVQLKDMGEDLECLCQIMRTVGPRLDHERAKSLMDQYFARMCSLMLSKELPARIRFLLQD
TVELREHHWVPRKAFLDNGPKTINQIRQDAVKDLGVFIPAPMAQGMRSDFFLEGPFMPPR
MKMDRDPLGGLADMFGQMPGSGIGTGPGVIQDRFSPTMGRHRSNQLFNGHGGHIMPPTQS
QFGEMGGKFMKSQGLSQLYHNQSQGLLSQLQGQSKDMPPRFSKKGQLNADEISLRPAQSF
LMNKNQVPKLQPQITMIPPSAQPPRTQTPPLGQTPQLGLKTNPPLIQEKPAKTSKKPPPS
KEELLKLTETVVTEYLNSGNANEAVNGVREMRAPKHFLPEMLSKVIILSLDRSDEDKEKA
SSLISLLKQEGIATSDNFMQAFLNVLDQCPKLEVDIPLVKSYLAQFAARAIISELVSISE
LAQPLESGTHFPLFLLCLQQLAKLQDREWLTELFQQSKVNMQKMLPEIDQNKDRMLEILE
GKGLSFLFPLLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVNILMTSFLQYI
SSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYN
SNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETAEEE
ESEEEAD
NT seq 2724 nt   +upstreamnt  +downstreamnt
gtggagagtgcgattgcagaagggggtgcttctcgtttcagtgcttcttcgggcggagga
ggaagtaggggtgcacctcagcactatcccaagactgctggcaacagcgagttcctgggg
aaaaccccagggcaaaacgctcagaaatggattcctgcacgaagcactagacgagatgac
aactccgcagcaaacaactccgcaaacgaaaaagaacgacatgatgcaatcttcaggaaa
gtaagaggcatactaaataagcttactcctgaaaagtttgacaagctatgccttgagctc
ctcaatgtgggtgtagagtctaaactcatccttaaaggggtcatactgctgattgtggac
aaagccctagaagagccaaagtatagctcactgtatgctcagctatgtctgcgattggca
gaagatgcaccaaactttgatggcccagcagcagagggtcaaccaggacagaagcaaagc
accacattcagacgcctcctaatttccaaattacaagatgaatttgaaaaccgaactaga
aatgttgatgtctatgataagcgtgaaaatcccctcctccccgaggaggaggaacagaga
gccattgctaagatcaagatgttgggaaacatcaaattcattggagagcttggcaagctt
gatcttattcacgaatctatccttcataagtgcatcaaaacacttttggaaaagaagaag
agagtccaactcaaagatatgggagaggatttggagtgcctctgtcagataatgaggaca
gtgggacctagattagaccatgaacgagccaagtccttaatggatcagtactttgcccga
atgtgctccttgatgttaagtaaggaattgccagcaaggattcgtttcctgctgcaggat
accgtagagttgcgagaacaccattgggttcctcgcaaggcttttcttgacaatggacca
aagacgatcaatcaaattcgtcaagatgcagtaaaagatctaggggtgtttattcctgct
cctatggctcaagggatgagaagtgacttctttctggagggaccgttcatgccacccagg
atgaaaatggatagggacccacttggaggacttgctgatatgtttggacaaatgccaggt
agcggaattggtactggtccaggagttatccaggatagattttcacccaccatgggacgt
catcgttcaaatcaactcttcaatggccatgggggacacatcatgcctcccacacaatcg
cagtttggagagatgggaggcaagtttatgaaaagccaggggctaagccagctctaccat
aaccagagtcagggactcttatcccagctgcaaggacagtcgaaggatatgccacctcgg
ttttctaagaaaggacagcttaatgcagatgagattagcctgaggcctgctcagtcgttc
ctaatgaataaaaatcaagtgccaaagcttcagccccagataactatgattcctcctagt
gcacaaccaccacgcactcaaacaccacctctgggacagacacctcagcttggtctcaaa
actaatccaccgcttatccaggaaaagcctgccaagaccagcaaaaagccaccaccgtca
aaggaagaactccttaaactaactgaaactgttgtgactgaatatctaaatagtggaaat
gcaaatgaggctgtcaatggtgtaagagaaatgagggctcctaaacactttcttcctgag
atgttaagcaaagtaatcatcctgtcactagatagaagcgatgaagataaagaaaaagca
agttctttgatcagtttactcaaacaggaagggatagccacaagtgacaacttcatgcag
gctttcctgaatgtattggaccagtgtcccaaactggaggttgacatccctttggtgaaa
tcctatttagcacagtttgcagctcgtgccatcatttcagagctggtgagcatttcagaa
ctagctcaaccactagaaagtggcacccattttcctctcttcctactttgtcttcagcag
ttagctaaattacaagatcgagaatggttaacagaactttttcaacaaagcaaggtcaat
atgcagaaaatgctcccagaaattgatcagaataaggaccgcatgttggagattttggaa
ggaaagggactgagtttcttattcccactcctcaaattggagaaggaactgttgaagcaa
ataaagttggatccatcccctcaaaccatatataaatggattaaagataacatctctccc
aaacttcatgtagataaaggatttgtgaacatcttaatgactagcttcttacagtacatt
tctagtgaagtaaacccccccagcgatgaaacagattcatcctctgctccttccaaagaa
cagttagagcaggaaaaacaactactactatctttcaagccagtaatgcagaaatttctt
catgatcacgttgatctacaagtcagtgccctgtatgctctccaggtgcactgctataac
agcaacttcccaaaaggcatgttacttcgcttttttgtgcacttctatgacatggaaatt
attgaagaagaagctttcttggcttggaaagaagatataacccaagagtttccgggaaaa
ggcaaggctttgttccaggtgaatcagtggctaacctggttagaaactgctgaagaagaa
gaatcagaggaagaagctgactaa

KEGG   Homo sapiens (human): 8672
Entry
8672              CDS       T01001                                 
Symbol
EIF4G3, eIF-4G_3, eIF4G_3, eIF4GII
Name
(RefSeq) eukaryotic translation initiation factor 4 gamma 3
  KO
K03260  translation initiation factor 4G
Organism
hsa  Homo sapiens (human)
Pathway
hsa05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    8672 (EIF4G3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    8672 (EIF4G3)
   03012 Translation factors [BR:hsa03012]
    8672 (EIF4G3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     8672 (EIF4G3)
   mRNA cycle factors
    Stress granule specific factors
     8672 (EIF4G3)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    8672 (EIF4G3)
SSDB
Motif
Pfam: MIF4G MA3 W2 PP_kinase
Other DBs
NCBI-GeneID: 8672
NCBI-ProteinID: NP_003751
OMIM: 603929
HGNC: 3298
Ensembl: ENSG00000075151
Pharos: O43432(Tbio)
UniProt: O43432 Q59GJ0
Structure
LinkDB
Position
1:complement(20806292..21176897)
AA seq 1585 aa
MNSQPQTRSPFFQRPQIQPPRATIPNSSPSIRPGAQTPTAVYQANQHIMMVNHLPMPYPV
PQGPQYCIPQYRHSGPPYVGPPQQYPVQPPGPGPFYPGPGPGDFPNAYGTPFYPSQPVYQ
SAPIIVPTQQQPPPAKREKKTIRIRDPNQGGKDITEEIMSGGGSRNPTPPIGRPTSTPTP
PQQLPSQVPEHSPVVYGTVESAHLAASTPVTAASDQKQEEKPKPDPVLKSPSPVLRLVLS
GEKKEQEGQTSETTAIVSIAELPLPPSPTTVSSVARSTIAAPTSSALSSQPIFTTAIDDR
CELSSPREDTIPIPSLTSCTETSDPLPTNENDDDICKKPCSVAPNDIPLVSSTNLINEIN
GVSEKLSATESIVEIVKQEVLPLTLELEILENPPEEMKLECIPAPITPSTVPSFPPTPPT
PPASPPHTPVIVPAAATTVSSPSAAITVQRVLEEDESIRTCLSEDAKEIQNKIEVEADGQ
TEEILDSQNLNSRRSPVPAQIAITVPKTWKKPKDRTRTTEEMLEAELELKAEEELSIDKV
LESEQDKMSQGFHPERDPSDLKKVKAVEENGEEAEPVRNGAESVSEGEGIDANSGSTDSS
GDGVTFPFKPESWKPTDTEGKKQYDREFLLDFQFMPACIQKPEGLPPISDVVLDKINQPK
LPMRTLDPRILPRGPDFTPAFADFGRQTPGGRGVPLLNVGSRRSQPGQRREPRKIITVSV
KEDVHLKKAENAWKPSQKRDSQADDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGL
TVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNR
CQKEFEKDKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELF
KLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIV
KERKTSSRIRFMLQDVIDLRLCNWVSRRADQGPKTIEQIHKEAKIEEQEEQRKVQQLMTK
EKRRPGVQRVDEGGWNTVQGAKNSRVLDPSKFLKITKPTIDEKIQLVPKAQLGSWGKGSS
GGAKASETDALRSSASSLNRFSALQPPAPSGSTPSTPVEFDSRRTLTSRGSMGREKNDKP
LPSATARPNTFMRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRE
SAKPEISAMSAHDKAALSEEELERKSKSIIDEFLHINDFKEAMQCVEELNAQGLLHVFVR
VGVESTLERSQITRDHMGQLLYQLVQSEKLSKQDFFKGFSETLELADDMAIDIPHIWLYL
AELVTPMLKEGGISMRELTIEFSKPLLPVGRAGVLLSEILHLLCKQMSHKKVGALWREAD
LSWKDFLPEGEDVHNFLLEQKLDFIESDSPCSSEALSKKELSAEELYKRLEKLIIEDKAN
DEQIFDWVEANLDEIQMSSPTFLRALMTAVCKAAIIADSSTFRVDTAVIKQRVPILLKYL
DSDTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEVISEDAFYKWESSKDPAEQNG
KGVALKSVTAFFTWLREAEEESEDN
NT seq 4758 nt   +upstreamnt  +downstreamnt
atgaattcacaacctcaaacccgttctccgtttttccagaggcctcaaatacagcctcct
agagctaccatcccgaacagcagtccttccattcgtcctggtgcacagacacccactgca
gtgtaccaggctaatcagcacatcatgatggttaaccatctgcccatgccgtacccagtg
ccccaggggcctcagtactgtataccacagtaccgtcatagtggccctccttatgttggg
cccccccaacaatatccagttcaaccaccggggccaggtcctttttatcctggaccagga
cctggggacttccccaatgcttatggaacgcctttttacccaagtcagccggtgtatcag
tcagcacctatcatagtgcctacgcagcaacagccgcctccagccaagagagagaaaaaa
actataagaattcgggatccaaaccagggaggtaaagacataacagaggagattatgtct
ggaggtggcagcagaaatcctactccacccataggaagacccacgtccacacctactcct
cctcagcagctgcccagccaggtccccgagcacagccctgtggtttatgggactgtggag
agcgctcatcttgctgccagcacccctgtcactgcagctagcgaccagaagcaagaggag
aagccaaaaccagatccagtgttaaagtctccttccccagtccttaggctagtcctcagt
ggagagaagaaagaacaagaaggccagacatctgaaactactgcaatagtatccatagca
gagcttcctctgcctccatcacctaccactgtttcttctgttgctcgaagtacaattgca
gcccccacctcttctgctcttagtagccaaccaatattcaccactgctatagatgacaga
tgtgaactctcatccccaagagaagacacaattcctatacccagcctcacatcttgcaca
gaaacatcagaccctttaccaacaaatgaaaatgatgatgatatatgcaagaaaccctgt
agtgtagcacctaatgatattccactggtttctagtactaacctaattaatgaaataaat
ggagttagcgaaaaattatcagccacggagagcattgtggaaatagtaaaacaggaagta
ttgccattgactcttgaattggagattctcgaaaatcccccagaagaaatgaaactggag
tgtatcccagctcccatcaccccttccacagttccttcctttcctccaactcctccaact
cctccagcttctcctcctcacactccagtcattgttcctgctgctgccactactgttagt
tctccgagtgctgccatcacagtccagagagtcctagaggaggacgagagcataagaact
tgccttagtgaagatgcaaaagagattcagaacaaaatagaggtagaagcagatgggcaa
acagaagagattttggattctcaaaacttaaattcaagaaggagccctgtcccagctcaa
atagctataactgtaccaaagacatggaagaaaccaaaagatcggacccgaaccactgaa
gagatgttagaggcagaattggagcttaaagctgaagaggagctttccattgacaaagta
cttgaatctgaacaagataaaatgagccaggggtttcatcctgaaagagacccctctgac
ctaaaaaaagtgaaagctgtggaagaaaatggagaagaagctgagccagtacgtaatggt
gctgagagtgtttctgagggtgaaggaatagatgctaattcaggctccacagatagttct
ggtgatggggttacatttccatttaaaccagaatcctggaagcctactgatactgaaggt
aagaagcagtatgacagggagtttctgctggacttccagttcatgcctgcctgtatacaa
aaaccagagggcctgcctcctatcagtgatgtggttcttgacaagatcaaccaacccaaa
ttgccaatgcgaactctggatcctcgaattttgcctcgaggaccagactttacaccagcc
tttgctgattttggaaggcagacacctggtggaagaggcgtacctttgttgaatgttggg
tcacgaagatctcaacctggccaaagaagagaacccagaaagatcatcacagtttctgta
aaagaagatgtacacctgaaaaaggcagaaaatgcctggaagccaagccaaaaacgagac
agccaagccgatgatcccgaaaacattaaaacccaggagctttttagaaaagttcgaagt
atcttaaataaattgacaccacagatgttcaatcaactgatgaagcaagtgtcaggactt
actgttgacacagaggagcggctgaaaggagttattgacctggtctttgagaaggctatt
gatgaacccagtttctctgtggcttacgcaaacatgtgtcgatgtctagtaacgctgaaa
gtacccatggcagacaagcctggtaacacagtgaatttccggaagctgctactgaaccgt
tgccagaaggagtttgaaaaagataaagcagatgatgatgtctttgagaagaagcagaaa
gaacttgaggctgccagtgctccagaggagaggacaaggcttcatgatgaactggaagaa
gccaaggacaaagcccggcggagatccattggcaacatcaagtttattggagaactcttt
aaactcaaaatgctgactgaagccatcatgcatgactgtgtggtgaagctgctaaagaac
catgatgaagaatccctggagtgcctgtgtcgcctgctcaccaccattggcaaagacttg
gactttgaaaaagcaaagccacgtatggaccagtactttaatcagatggagaaaattgtg
aaagaaagaaaaacctcatctaggattcggttcatgcttcaagatgttatagacctaagg
ctgtgcaattgggtatctcgaagagcagatcaagggcctaaaactatcgaacagattcac
aaagaggctaaaatagaagaacaagaagagcaaaggaaggtccagcaactcatgaccaaa
gagaagagaagaccaggtgtccagagagtggacgaaggtgggtggaacactgtacaaggg
gccaagaacagtcgggtactggacccctcaaaattcctaaaaatcactaagcctacaatt
gatgaaaaaattcagctggtacctaaagcacagctaggcagctggggaaaaggcagcagt
ggtggagcaaaggcaagtgagactgatgccttacggtcaagtgcttccagtttaaacaga
ttctctgccctgcaacctccagcaccctcagggtccacgccatccacgcctgtagagttt
gattcccgaaggaccttaactagtcgtggaagtatgggcagggagaagaatgacaagccc
cttccatctgcaacagctcggccaaatactttcatgaggggtggcagcagtaaagacctg
ctagacaatcagtctcaagaagagcagcggagagagatgctggagaccgtgaagcagctc
acaggaggtgtggatgtggagaggaacagcactgaggctgagcgaaataaaacaagggag
tcagcaaaaccagaaatttcagcaatgtcagctcatgacaaggctgcattatcagaagag
gaactggagaggaagtcgaaatctatcattgatgaatttctacacattaatgattttaag
gaagccatgcagtgtgtggaagagctgaatgcccagggcctactacatgtttttgtgaga
gtgggagtggagtccaccctggaaaggagccagatcaccagggatcacatgggccaatta
ctctatcagctggtacagtcagaaaaactcagcaaacaggactttttcaaaggtttttca
gaaactttggaattggcagatgacatggccattgatattccccatatttggttgtacctt
gctgaactggtgacccccatgttaaaagaaggtggaatctccatgagagaacttaccata
gaatttagcaaacctttacttcctgttggaagagctggggtcttgctatctgaaatattg
cacctactatgcaaacaaatgagccataagaaagtgggagccttatggagggaggctgac
ctcagctggaaggactttttaccagaaggagaagatgtacataattttcttttggagcag
aagttggacttcatagagtctgacagtccctgttcctctgaagcactttcaaagaaagaa
ctgtctgccgaagagctgtataagcgactcgagaaactcattattgaggacaaagcgaat
gatgaacagatctttgactgggtagaggctaatctagacgaaatccagatgagttcacct
acattccttagagctttaatgactgctgtttgtaaagcagctattatagccgactcttct
accttcagagtggacactgctgttatcaagcagagagtgccgatcttactcaagtaccta
gactcagatacagagaaggaactgcaagcactttatgcactacaagcatcgatagtaaaa
cttgatcaacctgccaatttgctgcggatgttttttgattgtctatatgacgaggaggtg
atctccgaggatgccttctacaaatgggagagcagcaaggaccctgcagagcagaatggg
aagggcgtggctctgaaatctgtcacggcattcttcacgtggctgcgggaagcagaagag
gagtctgaggataactaa

DBGET integrated database retrieval system