KEGG   Homo sapiens (human): 200186
Entry
200186            CDS       T01001                                 

Gene name
CRTC2, TORC-2, TORC2
Definition
(RefSeq) CREB regulated transcription coactivator 2
  KO
K16333  CREB-regulated transcription coactivator 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    200186 (CRTC2)
   04152 AMPK signaling pathway
    200186 (CRTC2)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    200186 (CRTC2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    200186 (CRTC2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    200186 (CRTC2)
SSDB
Motif
Pfam: TORC_M TORC_C TORC_N
Other DBs
NCBI-GeneID: 200186
NCBI-ProteinID: NP_859066
OMIM: 608972
HGNC: 27301
Ensembl: ENSG00000160741
Vega: OTTHUMG00000037156
Pharos: Q53ET0(Tbio)
UniProt: Q53ET0
LinkDB
Structure
PDB: 
4HTM

Position
1q21.3
AA seq 693 aa
MATSGANGPGSATASASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLA
YTRSSHYGGSLPNVNQIGSGLAEFQSPLHSPLDSSRSTRHHGLVERVQRDPRRMVSPLRR
YTRHIDSSPYSPAYLSPPPESSWRRTMAWGNFPAEKGQLFRLPSALNRTSSDSALHTSVM
NPSPQDTYPGPTPPSILPSRRGGILDGEMDPKVPAIEENLLDDKHLLKPWDAKKLSSSSS
RPRSCEVPGINIFPSPDQPANVPVLPPAMNTGGSLPDLTNLHFPPPLPTPLDPEETAYPS
LSGGNSTSNLTHTMTHLGISRGMGLGPGYDAPGLHSPLSHPSLQSSLSNPNLQASLSSPQ
PQLQGSHSHPSLPASSLARHVLPTTSLGHPSLSAPALSSSSSSSSTSSPVLGAPSYPAST
PGASPHHRRVPLSPLSLLAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLSTD
QRLPPYPYSSPSLVLPTQPHTPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPS
GHGQQSYHRPMSDFNLGNLEQFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTF
NHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGLEDELRM
EPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ
NT seq 2082 nt   +upstreamnt  +downstreamnt
atggcgacgtcgggggcgaacgggcctggttcggccacggcctcggcttccaatccgcgc
aaatttagtgagaagattgcgctgcagaagcagcgtcaggccgaggagacggcggccttc
gaggaggtgatgatggacatcggctccacccggttacaggcccaaaaactgcgactggca
tacacaaggagctctcattatggtgggtctctgcccaatgttaaccagattggctctggc
ctggccgagttccagagccccctccactcacctttggattcatctcggagcactcggcac
catgggctggtggaacgggtgcagcgagatcctcgaagaatggtgtccccacttcgccga
tacacccgccacattgacagctctccctatagtcctgcctacttatctcctcccccagag
tctagctggcgaaggacgatggcctggggcaatttccctgcagagaaggggcagttgttt
cgactaccatctgcacttaacaggacaagctctgactctgcccttcatacaagtgtgatg
aaccccagtccccaggatacctacccaggccccacacctcccagcatcctgcccagccga
cgtgggggtattctggatggtgaaatggaccccaaagtacctgctattgaggagaacttg
ctagatgacaagcatttgctgaagccatgggatgctaagaagctatcctcatcctcttcc
cgacctcggtcctgtgaagtccctggaattaacatctttccatctcctgaccagcctgcc
aatgtgcctgtcctcccacctgccatgaacacggggggctccctacctgacctcaccaac
ctgcactttcccccaccactgcccacccccctggaccctgaagagacagcctaccctagc
ctgagtgggggcaacagtacctccaatttgacccacaccatgactcacctgggcatcagc
aggggcatgggcctgggcccaggctatgatgcaccaggacttcattcacctctcagccac
ccatccctgcagtcctccctaagcaatcccaacctccaggcttccctgagcagtcctcag
ccccagcttcagggctcccacagccacccctctctgcctgcctcctccttggcccgccat
gtactgcccaccacctccctgggccacccctcactcagtgctccggctctctcctcctcc
tcttcctcctcctccacttcatctcctgttttgggcgccccctcttaccctgcttctacc
cctggggcctccccccaccaccgccgtgtgcccctcagccccctgagtttgctcgcgggc
ccagccgacgccagaaggtcccaacagcagctgcccaaacagttttcgccaacaatgtca
cccaccttgtcttccatcactcagggcgtccccctggataccagtaaactgtccactgac
cagcggttacccccatacccatacagctccccaagtctggttctgcctacccagccccac
accccaaagtctctacagcagccagggctgccctctcagtcttgttcagtgcagtcctca
ggtgggcagcccccaggcaggcagtctcattatgggacaccgtacccacctgggcccagt
gggcatgggcaacagtcttaccaccggccaatgagtgacttcaacctggggaatctggag
cagttcagcatggagagcccatcagccagcctggtgctggatccccctggcttttctgaa
gggcctggatttttagggggtgaggggccaatgggtggcccccaggatccccacaccttc
aaccaccagaacttgacccactgttcccgccatggctcagggcctaacatcatcctcaca
ggggactcctctccaggtttctctaaggagattgcagcagccctggccggagtgcctggc
tttgaggtgtcagcagctggattggagctagggcttgggctagaagatgagctgcgcatg
gagccactgggcctggaagggctaaacatgctgagtgacccctgtgccctgctgcctgat
cctgctgtggaggagtcattccgcagtgaccggctccaatga

DBGET integrated database retrieval system