KEGG   Homo sapiens (human): 200942
Entry
200942            CDS       T01001                                 
Symbol
KLHDC8B, CHL
Name
(RefSeq) kelch domain containing 8B
Organism
hsa  Homo sapiens (human)
Disease
H00007  Hodgkin lymphoma
SSDB
Motif
Pfam: Kelch_1 Kelch_6 Kelch_3 Kelch_4 Kelch_2 Kelch_5 DUF1668
Other DBs
NCBI-GeneID: 200942
NCBI-ProteinID: NP_775817
OMIM: 613169
HGNC: 28557
Ensembl: ENSG00000185909
Pharos: Q8IXV7(Tdark)
UniProt: Q8IXV7 Q96DZ8
LinkDB
Position
3:49171598..49176486
AA seq 354 aa
MSAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAETLDMASHTWL
ALAPLPTARAGAAAVVLGKQVLVVGGVDEVQSPVAAVEAFLMDEGRWERRATLPQAAMGV
ATVERDGMVYALGGMGPDTAPQAQVRVYEPRRDCWLSLPSMPTPCYGASTFLHGNKIYVL
GGRQGKLPVTAFEAFDLEARTWTRHPSLPSRRAFAGCAMAEGSVFSLGGLQQPGPHNFYS
RPHFVNTVEMFDLEHGSWTKLPRSLRMRDKRADFVVGSLGGHIVAIGGLGNQPCPLGSVE
SFSLARRRWEALPAMPTARCSCSSLQAGPRLFVIGGVAQGPSQAVEALCLRDGV
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgtctgcaggaggtggccgggcctttgcttggcaagtgttcccccccatgcccacttgc
cgggtctatggcacagtggcacaccaagatgggcacctgctggtgttggggggttgtggc
cgggctggactgcccctggacactgctgagacactggacatggcctcgcacacatggctg
gcactggcacccctgcccactgcccgggctggtgcagctgcggtagttctgggcaagcag
gtgctagtggtgggtggtgtggatgaggtccagagcccggtagctgctgtagaggccttc
ctgatggatgagggccgctgggagcgtcgggccaccctccctcaagcagccatgggggtt
gcaactgtggagagagatggtatggtgtatgctctggggggaatgggccctgacacggcc
ccccaggcccaggtacgtgtgtatgagccccgtcgggactgctggctttcgctaccctcc
atgcccacaccctgctatggggcctccaccttcctgcacgggaacaagatctatgtcctg
gggggccgccagggcaagctcccggtgactgcttttgaagcctttgatctggaggcccgt
acatggacccggcatccaagcctacccagccgtcgggcctttgctggctgcgccatggct
gaaggcagcgtctttagcctgggtggcctgcagcagcctgggccccacaacttctactct
cgcccacactttgtcaacactgtggagatgtttgacctggagcatgggtcctggaccaaa
ttgccccgcagcctgcgcatgagggataagagggcagactttgtggttgggtcccttggg
ggccacattgtggccattgggggccttggaaaccagccatgtcctttgggctctgtggag
agctttagccttgcacggcggcgctgggaggcattgcctgccatgcccactgcccgctgc
tcctgctctagtctgcaggctgggccccggctgtttgttattgggggtgtggcccagggc
cccagtcaagccgtggaggcactgtgtctgcgtgatggggtctga

DBGET integrated database retrieval system