KEGG   Homo sapiens (human): 2028
Entry
2028              CDS       T01001                                 

Gene name
ENPEP, APA, CD249, gp160
Definition
(RefSeq) glutamyl aminopeptidase
  KO
K11141  glutamyl aminopeptidase [EC:3.4.11.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    2028 (ENPEP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    2028 (ENPEP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2028 (ENPEP)
   04090 CD molecules [BR:hsa04090]
    2028 (ENPEP)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     2028 (ENPEP)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M1
   2028 (ENPEP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2028 (ENPEP)
CD molecules [BR:hsa04090]
 Proteins
  2028 (ENPEP)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Cyclophil_like DUF1570
Other DBs
NCBI-GeneID: 2028
NCBI-ProteinID: NP_001968
OMIM: 138297
HGNC: 3355
Ensembl: ENSG00000138792
Vega: OTTHUMG00000132546
Pharos: Q07075(Tchem)
UniProt: Q07075
LinkDB
Structure
PDB: 

Position
4q25
AA seq 957 aa
MNFAEREGSKRYCIQTKHVAILCAVVVGVGLIVGLAVGLTRSCDSSGDGGPGTAPAPSHL
PSSTASPSGPPAQDQDICPASEDESGQWKNFRLPDFVNPVHYDLHVKPLLEEDTYTGTVS
ISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEYVVVEAEEELTPS
SGDGLYLLTMEFAGWLNGSLVGFYRTTYTENGQVKSIVATDHEPTDARKSFPCFDEPNKK
ATYTISITHPKEYGALSNMPVAKEESVDDKWTRTTFEKSVPMSTYLVCFAVHQFDSVKRI
SNSGKPLTIYVQPEQKHTAEYAANITKSVFDYFEEYFAMNYSLPKLDKIAIPDFGTGAME
NWGLITYRETNLLYDPKESASSNQQRVATVVAHELVHQWFGNIVTMDWWEDLWLNEGFAS
FFEFLGVNHAETDWQMRDQMLLEDVLPVQEDDSLMSSHPIIVTVTTPDEITSVFDGISYS
KGSSILRMLEDWIKPENFQKGCQMYLEKYQFKNAKTSDFWAALEEASRLPVKEVMDTWTR
QMGYPVLNVNGVKNITQKRFLLDPRANPSQPPSDLGYTWNIPVKWTEDNITSSVLFNRSE
KEGITLNSSNPSGNAFLKINPDHIGFYRVNYEVATWDSIATALSLNHKTFSSADRASLID
DAFALARAQLLDYKVALNLTKYLKREENFLPWQRVISAVTYIISMFEDDKELYPMIEEYF
QGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPV
NLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLK
DTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFN
TELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREWFFNLLESG
NT seq 2874 nt   +upstreamnt  +downstreamnt
atgaactttgcggagagagagggctctaagagatactgcattcaaacgaaacatgtggcc
attctctgtgcggtggtggtgggtgtaggattaatagtgggacttgccgtgggcttgacc
agatcgtgtgactccagcggggacggcgggccgggcactgcgccagctccttcccacctg
ccttcttccacggccagcccctcaggtcctcctgcccaggaccaggacatctgcccggcc
agtgaggatgagagcggacagtggaaaaactttcgactgccggacttcgtcaacccagtc
cactacgacctgcacgtgaagcccctgttggaggaggacacctacacgggcaccgtgagc
atctccatcaacctgagcgctcccacccggtacctgtggctgcacctccgggagaccagg
atcacccggctcccggagctgaagaggccctctggggaccaggtgcaagtccggaggtgt
ttcgagtacaaaaagcaggagtacgtggtggtcgaggcggaggaagagcttacccccagc
agtggagatggcctgtatctcctgaccatggagttcgccggctggctgaacggctccctc
gtgggattttatagaaccacctacacggagaacggacaagtcaagagcatagtggccacc
gatcatgaaccaacagatgccaggaaatcttttccttgttttgatgagcccaacaaaaag
gcaacttatacaatatctatcacccatcccaaagaatacggagcactttcaaatatgcca
gtggcgaaagaagagtcagtggatgataaatggactcgaacaacttttgagaagtctgtc
cccatgagcacgtacctggtgtgctttgctgtacatcaatttgactctgtaaagagaata
tcaaatagtggaaaacctcttacaatttatgtccagccagagcaaaagcacacagccgaa
tatgctgcaaacataactaaaagtgtgtttgattattttgaagaatactttgctatgaat
tattctcttcctaaattagataaaatcgctattccagattttggcactggtgccatggag
aactggggactcatcacgtacagagaaacgaacctgctttatgaccctaaggaatcagcc
tcatcaaaccaacagagggtggccactgtggttgcccatgaacttgtgcatcagtggttt
ggaaatattgtgaccatggactggtgggaagacttgtggctaaatgaaggatttgcttct
ttctttgagtttctgggagtaaaccatgcagaaacagactggcaaatgcgtgaccaaatg
ttacttgaagatgtattacctgttcaagaggatgattctttgatgtcttcgcatccaatt
attgtgactgtgacaacccctgatgaaataacatctgtttttgatggaatatcctatagc
aagggatcttctattttgagaatgcttgaagactggataaaaccagagaattttcaaaaa
ggatgtcagatgtacttggaaaaataccaattcaagaatgcaaaaacttctgatttttgg
gcagcactggaagaggcaagtaggctaccagtgaaagaagtaatggacacctggaccaga
cagatgggttatcctgtgcttaacgtgaacggtgtcaagaacatcacacagaaacgcttt
ttgttggacccaagagctaacccttctcagcccccttcagatcttggttatacatggaat
atcccagttaaatggactgaagataatataacaagcagtgtgttatttaataggtcagaa
aaagaaggaatcactttgaactcctctaatcctagtggaaatgcttttctcaaaataaac
ccagatcatattgggttttatcgtgtaaattatgaagtagcaacttgggactcgatagct
acagcgctctccttgaaccacaagacattttcttcagcagatcgtgcaagtcttattgat
gatgcttttgccttggcaagagctcaacttctagattataaggtggctttgaacttgacc
aagtatctcaaaagggaagagaattttttaccatggcagagagtaatttcagctgtaacc
tacatcattagcatgtttgaagatgataaagagctatatcctatgattgaggaatacttc
caaggtcaagtgaagcctattgcagattctctgggatggaatgatgctggagaccatgtc
acaaagttactccgttcctccgtgttagggtttgcgtgcaagatgggagacagagaagcc
ttgaacaatgcttcctcgttatttgagcagtggctaaatgggactgtaagccttcccgta
aatctcaggcttctggtgtatcggtatgggatgcagaactctggcaatgagatttcatgg
aactacactcttgagcaataccagaaaacttcattagctcaagaaaaagaaaaactgctg
tatggattagcatcagtgaagaacgttactcttttgtcaaggtatttggatttgctcaag
gacacgaaccttattaaaactcaggatgtgtttacagtcattcgatatatctcatataac
agctatgggaagaacatggcctggaattggatacaactcaactgggactatctagtcaac
agatatacactcaataacagaaaccttggccgaattgtcacaatagcagagccattcaac
actgaactgcaactgtggcagatggagagcttttttgcaaaatatccacaagctggagca
ggagaaaaacctagggaacaagtgctggaaacagtgaaaaacaatatagagtggctaaaa
caacatagaaacaccatcagagaatggttttttaatttacttgagagtggttaa

DBGET integrated database retrieval system