KEGG   Homo sapiens (human): 2103
Entry
2103              CDS       T01001                                 
Symbol
ESRRB, DFNB35, ERR_beta-2, ERR2, ERRb, ERRbeta2, ESRL2, NR3B2
Name
(RefSeq) estrogen related receptor beta
  KO
K08553  estrogen-related receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Disease
H00605  Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    2103 (ESRRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2103 (ESRRB)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    2103 (ESRRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    2103 (ESRRB)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    2103 (ESRRB)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    2103 (ESRRB)
Nuclear receptors [BR:hsa03310]
 3. Estrogen like
  3B. Estrogen-related receptor
   2103 (ESRRB)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 2103
NCBI-ProteinID: NP_004443
OMIM: 602167
HGNC: 3473
Ensembl: ENSG00000119715
Vega: OTTHUMG00000160457
Pharos: O95718(Tchem)
UniProt: O95718
Structure
LinkDB
Position
14:76310777..76501837
AA seq 508 aa
MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPP
MFAGAGLGGTPCRKSYEDCASGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASC
EACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRG
GRQKYKRRLDSESSPYLSLQISPPAKKPLTKIVSYLLVAEPDKLYAMPPPGMPEGDIKAL
TTLCDLADRELVVIIGWAKHIPGFSSLSLGDQMSLLQSAWMEILILGIVYRSLPYDDKLV
YAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALANSDSMYIEDL
EAVQKLQDLLHEALQDYELSQRHEEPWRTGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVP
MHKLFLEMLEAKVGQEQLRGSPKDERMSSHDGKCPFQSAAFTSRDQSNSPGIPNPRPSSP
TPLNERGRQISPSTRTPGGQGKHLWLTM
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgtcctcggacgacaggcacctgggctccagctgcggctccttcatcaagactgagccg
tccagcccgtcctcgggcatcgatgccctcagccaccacagccccagtggctcgtccgac
gccagcggcggctttggcctggccctgggcacccacgccaacggtctggactcgccaccc
atgtttgcaggcgccgggctgggaggcaccccatgccgcaagagctacgaggactgtgcc
agcggcatcatggaggactcggccatcaagtgcgagtacatgctcaacgccatccccaag
cgcctgtgcctcgtgtgcggggacattgcctctggctaccactacggcgtggcctcctgc
gaggcttgcaaggccttcttcaagaggactatccaagggaacattgagtacagctgcccg
gccaccaacgagtgcgagatcaccaaacggaggcgcaagtcctgccaggcctgccgcttc
atgaaatgcctcaaagtggggatgctgaaggaaggtgtgcgccttgatcgagtgcgtgga
ggccgtcagaaatacaagcgacggctggactcagagagcagcccatacctgagcttacaa
atttctccacctgctaaaaagccattgaccaagattgtctcatacctactggtggctgag
ccggacaagctctatgccatgcctccccctggtatgcctgagggggacatcaaggccctg
accactctctgtgacctggcagaccgagagcttgtggtcatcattggctgggccaagcac
atcccaggcttctcaagcctctccctgggggaccagatgagcctgctgcagagtgcctgg
atggaaatcctcatcctgggcatcgtgtaccgctcgctgccctatgacgacaagctggtg
tacgctgaggactacatcatggatgaggagcactcccgcctcgcggggctgctggagctc
taccgggccatcctgcagctggtacgcaggtacaagaagctcaaggtggagaaggaggag
tttgtgacgctcaaggccctggccctcgccaactccgattccatgtacatcgaggatcta
gaggctgtccagaagctgcaggacctgctgcacgaggcactgcaggactacgagctgagc
cagcgccatgaggagccctggaggacgggcaagctgctgctgacactgccgctgctgcgg
cagacggccgccaaggccgtgcagcacttctatagcgtcaaactgcagggcaaagtgccc
atgcacaaactcttcctggagatgctggaggccaaggttggccaagagcagcttagagga
tctcccaaggatgaaagaatgtcaagccatgatggaaaatgccccttccaatcagctgcc
ttcacaagcagggatcagagcaactccccggggatccccaatccacgcccttctagtcca
acccccctcaatgagagaggcaggcagatctcacccagcactaggacaccaggaggccag
ggaaagcatctctggctcaccatgtaa

DBGET integrated database retrieval system