KEGG   Homo sapiens (human): 2160
Entry
2160              CDS       T01001                                 
Symbol
F11, FXI, PTA
Name
(RefSeq) coagulation factor XI
  KO
K01323  coagulation factor XI [EC:3.4.21.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Network
nt06514  Coagulation cascade
  Element
N01507  Intrinsic pathway of coagulation cascade, F11 activation
Disease
H00938  Factor XI deficiency
Drug target
Milvexian: D11802
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    2160 (F11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    2160 (F11)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.27  coagulation factor XIa
     2160 (F11)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   2160 (F11)
SSDB
Motif
Pfam: Trypsin PAN_1 PAN_4 Trypsin_2 DUF1986 MANEC
Other DBs
NCBI-GeneID: 2160
NCBI-ProteinID: NP_000119
OMIM: 264900
HGNC: 3529
Ensembl: ENSG00000088926
Pharos: P03951(Tchem)
CPD: C03262
UniProt: P03951
Structure
LinkDB
Position
4:186266189..186289681
AA seq 625 aa
MIFLYQVVHFILFTSVSGECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFT
FTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDM
KGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITK
LDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFT
FFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTD
FLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKIL
HGRGGISGYTLRLCKMDNECTTKIKPRIVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSI
IGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFGVQEIIIHDQYKMAESGYD
IALLKLETTVNYTDSQRPICLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLV
TNEECQKRYRGHKITHKMICAGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCA
QRERPGVYTNVVEYVDWILEKTQAV
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgattttcttatatcaagtggtacatttcattttatttacttcagtttctggtgaatgt
gtgactcagttgttgaaggacacctgctttgaaggaggggacattactacggtcttcaca
ccaagcgccaagtactgccaggtagtctgcacttaccacccaagatgtttactcttcact
ttcacggcggaatcaccatctgaggatcccacccgatggtttacttgtgtcctgaaagac
agtgttacagaaacactgccaagagtgaataggacagcagcgatttctgggtattctttc
aagcaatgctcacaccaaataagcgcttgcaacaaagacatttatgtggacctagacatg
aagggcataaactataacagctcagttgccaagagtgctcaagaatgccaagaaagatgc
acggatgacgtccactgccactttttcacgtacgccacaaggcagtttcccagcctggag
catcgtaacatttgtctactgaagcacacccaaacagggacaccaaccagaataacgaag
ctcgataaagtggtgtctggattttcactgaaatcctgtgcactttctaatctggcttgt
attagggacattttccctaatacggtgtttgcagacagcaacatcgacagtgtcatggct
cccgatgcttttgtctgtggccgaatctgcactcatcatcccggttgcttgttttttacc
ttcttttcccaggaatggcccaaagaatctcaaagaaatctttgtctccttaaaacatct
gagagtggattgcccagtacacgcattaaaaagagcaaagctctttctggtttcagtcta
caaagctgcaggcacagcatcccagtgttctgccattcttcattttaccatgacactgat
ttcttgggagaagaactggatattgttgctgcaaaaagtcacgaggcctgccagaaactg
tgcaccaatgccgtccgctgccagttttttacctataccccagcccaagcatcctgcaac
gaagggaagggcaagtgttacttaaagctttcttcaaacggatctccaactaaaatactt
cacgggagaggaggcatctctggatacacattaaggttgtgtaaaatggataatgagtgt
accaccaaaatcaagcccaggatcgttggaggaactgcgtctgttcgtggtgagtggccg
tggcaggtgaccctgcacacaacctcacccactcagagacacctgtgtggaggctccatc
attggaaaccagtggatattaacagccgctcactgtttctatggggtagagtcacctaag
attttgcgtgtctacagtggcattttaaatcaatctgaaataaaagaggacacatctttc
tttggggttcaagaaataataatccatgatcagtataaaatggcagaaagcgggtatgat
attgccttgttgaaactggaaaccacagtgaattacacagattctcaacgacccatatgc
ctgccttccaaaggagatagaaatgtaatatacactgattgctgggtgactggatggggg
tacagaaaactaagagacaaaatacaaaatactctccagaaagccaagatacccttagtg
accaacgaagagtgccagaagagatacagaggacataaaataacccataagatgatctgt
gccggctacagggaaggagggaaggacgcttgcaagggagattcgggaggccctctgtcc
tgcaaacacaatgaggtctggcatctggtaggcatcacgagctggggcgaaggctgtgct
caaagggagcggccaggtgtttacaccaacgtggtcgagtacgtggactggattctggag
aaaactcaagcagtgtga

DBGET integrated database retrieval system