Homo sapiens (human): 2207 Help Entry 2207              CDS       T01001                                  Symbol FCER1G, FCRG Name (RefSeq) Fc epsilon receptor Ig   KO K07983   high affinity immunoglobulin epsilon receptor subunit gamma Organism hsa  Homo sapiens (human) Pathway hsa04071   Sphingolipid signaling pathway hsa04072   Phospholipase D signaling pathway hsa04611   Platelet activation hsa04625   C-type lectin receptor signaling pathway hsa04650   Natural killer cell mediated cytotoxicity hsa04664   Fc epsilon RI signaling pathway hsa05152   Tuberculosis hsa05310   Asthma Drug target Benzylpenicilloyl polylysine:  D03095<US> Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     2207 (FCER1G)    04071 Sphingolipid signaling pathway     2207 (FCER1G)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     2207 (FCER1G)    04625 C-type lectin receptor signaling pathway     2207 (FCER1G)    04650 Natural killer cell mediated cytotoxicity     2207 (FCER1G)    04664 Fc epsilon RI signaling pathway     2207 (FCER1G)  09160 Human Diseases   09171 Infectious disease: bacterial    05152 Tuberculosis     2207 (FCER1G)   09163 Immune disease    05310 Asthma     2207 (FCER1G)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     2207 (FCER1G) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of microglial cells    2207 (FCER1G) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TCR_zetazeta ITAM YlcJ Motif Other DBs NCBI-GeneID:  2207 NCBI-ProteinID:  NP_004097 OMIM:  147139 HGNC:  3611 Ensembl:  ENSG00000158869 UniProt:  P30273 Structure PDBPDBj LinkDB All DBs Position 1:161215295..161219245 Genome browser AA seq 86 aa AA seqDB search MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEK SDGVYTGLSTRNQETYETLKHEKPPQ NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgattccagcagtggtcttgctcttactccttttggttgaacaagcagcggccctggga gagcctcagctctgctatatcctggatgccatcctgtttctgtatggaattgtcctcacc ctcctctactgtcgactgaagatccaagtgcgaaaggcagctataaccagctatgagaaa tcagatggtgtttacacgggcctgagcaccaggaaccaggagacttacgagactctgaag catgagaaaccaccacagtag

DBGET integrated database retrieval system