KEGG   Homo sapiens (human): 226
Entry
226               CDS       T01001                                 
Symbol
ALDOA, ALDA, GSD12, HEL-S-87p
Name
(RefSeq) aldolase, fructose-bisphosphate A
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00030  Pentose phosphate pathway
hsa00051  Fructose and mannose metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa04066  HIF-1 signaling pathway
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
Disease
H00069  Glycogen storage disease
H01762  Muscle glycogen storage disease
H01952  Glycogen storage disease type XII
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    226 (ALDOA)
   00030 Pentose phosphate pathway
    226 (ALDOA)
   00051 Fructose and mannose metabolism
    226 (ALDOA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    226 (ALDOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    226 (ALDOA)
   03036 Chromosome and associated proteins [BR:hsa03036]
    226 (ALDOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    226 (ALDOA)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     226 (ALDOA)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    226 (ALDOA)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    226 (ALDOA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   226 (ALDOA)
SSDB
Motif
Pfam: Glycolytic
Other DBs
NCBI-GeneID: 226
NCBI-ProteinID: NP_001121089
OMIM: 103850
HGNC: 414
Ensembl: ENSG00000149925
Pharos: P04075(Tbio)
UniProt: P04075 V9HWN7
Structure
LinkDB
Position
16:30064279..30070420
AA seq 364 aa
MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYR
QLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTN
GETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQ
NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHAC
TQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTF
SYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVS
NHAY
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgccctaccaatatccagcactgaccccggagcagaagaaggagctgtctgacatcgct
caccgcatcgtggcacctggcaagggcatcctggctgcagatgagtccactgggagcatt
gccaagcggctgcagtccattggcaccgagaacaccgaggagaaccggcgcttctaccgc
cagctgctgctgacagctgacgaccgcgtgaacccctgcattgggggtgtcatcctcttc
catgagacactctaccagaaggcggatgatgggcgtcccttcccccaagttatcaaatcc
aagggcggtgttgtgggcatcaaggtagacaagggcgtggtccccctggcagggacaaat
ggcgagactaccacccaagggttggatgggctgtctgagcgctgtgcccagtacaagaag
gacggagctgacttcgccaagtggcgttgtgtgctgaagattggggaacacaccccctca
gccctcgccatcatggaaaatgccaatgttctggcccgttatgccagtatctgccagcag
aatggcattgtgcccatcgtggagcctgagatcctccctgatggggaccatgacttgaag
cgctgccagtatgtgaccgagaaggtgctggctgctgtctacaaggctctgagtgaccac
cacatctacctggaaggcaccttgctgaagcccaacatggtcaccccaggccatgcttgc
actcagaagttttctcatgaggagattgccatggcgaccgtcacagcgctgcgccgcaca
gtgccccccgctgtcactgggatcaccttcctgtctggaggccagagtgaggaggaggcg
tccatcaacctcaatgccattaacaagtgccccctgctgaagccctgggccctgaccttc
tcctacggccgagccctgcaggcctctgccctgaaggcctggggcgggaagaaggagaac
ctgaaggctgcgcaggaggagtatgtcaagcgagccctggccaacagccttgcctgtcaa
ggaaagtacactccgagcggtcaggctggggctgctgccagcgagtccctcttcgtctct
aaccacgcctattaa

KEGG   Homo sapiens (human): 229
Entry
229               CDS       T01001                                 
Symbol
ALDOB, ALDB, ALDO2
Name
(RefSeq) aldolase, fructose-bisphosphate B
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00030  Pentose phosphate pathway
hsa00051  Fructose and mannose metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa04066  HIF-1 signaling pathway
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
Disease
H00071  Hereditary fructose intolerance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    229 (ALDOB)
   00030 Pentose phosphate pathway
    229 (ALDOB)
   00051 Fructose and mannose metabolism
    229 (ALDOB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    229 (ALDOB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    229 (ALDOB)
   03036 Chromosome and associated proteins [BR:hsa03036]
    229 (ALDOB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    229 (ALDOB)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     229 (ALDOB)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    229 (ALDOB)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    229 (ALDOB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   229 (ALDOB)
SSDB
Motif
Pfam: Glycolytic
Other DBs
NCBI-GeneID: 229
NCBI-ProteinID: NP_000026
OMIM: 612724
HGNC: 417
Ensembl: ENSG00000136872
Pharos: P05062(Tbio)
UniProt: P05062 A0A024R145
Structure
LinkDB
Position
9:complement(101420560..101435774)
AA seq 364 aa
MAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFR
EILFSVDSSINQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTN
KETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYASICQQ
NGLVPIVEPEVIPDGDHDLEHCQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHAC
TKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSF
SYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAASTQSLFTA
CYTY
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggcccaccgatttccagccctcacccaggagcagaagaaggagctctcagaaattgcc
cagagcattgttgccaatggaaaggggatcctggctgcagatgaatctgtaggtaccatg
gggaaccgcctgcagaggatcaaggtggaaaacactgaagagaaccgccggcagttccga
gaaatcctcttctctgtggacagttccatcaaccagagcatcgggggtgtgatccttttc
cacgagaccctctaccagaaggacagccagggaaagctgttcagaaacatcctcaaggaa
aaggggatcgtggtgggaatcaagttagaccaaggaggtgctcctcttgcaggaacaaac
aaagaaaccaccattcaagggcttgatggcctctcagagcgctgtgctcagtacaagaaa
gatggtgttgactttgggaagtggcgtgctgtgctgaggattgccgaccagtgtccatcc
agcctcgctatccaggaaaacgccaacgccctggctcgctacgccagcatctgtcagcag
aatggactggtacctattgttgaaccagaggtaattcctgatggagaccatgacctggaa
cactgccagtatgttactgagaaggtcctggctgctgtctacaaggccctgaatgaccat
catgtttacctggagggcaccctgctaaagcccaacatggtgactgctggacatgcctgc
accaagaagtatactccagaacaagtagctatggccaccgtaacagctctccaccgtact
gttcctgcagctgttcctggcatctgctttttgtctggtggcatgagtgaagaggatgcc
actctcaacctcaatgctatcaacctttgccctctaccaaagccctggaaactaagtttc
tcttatggacgggccctgcaggccagtgcactggctgcctggggtggcaaggctgcaaac
aaggaggcaacccaggaggcttttatgaagcgggccatggctaactgccaggcggccaaa
ggacagtatgttcacacgggttcttctggggctgcttccacccagtcgctcttcacagcc
tgctatacctactag

KEGG   Homo sapiens (human): 230
Entry
230               CDS       T01001                                 
Symbol
ALDOC, ALDC
Name
(RefSeq) aldolase, fructose-bisphosphate C
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00030  Pentose phosphate pathway
hsa00051  Fructose and mannose metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa04066  HIF-1 signaling pathway
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    230 (ALDOC)
   00030 Pentose phosphate pathway
    230 (ALDOC)
   00051 Fructose and mannose metabolism
    230 (ALDOC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    230 (ALDOC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    230 (ALDOC)
   03036 Chromosome and associated proteins [BR:hsa03036]
    230 (ALDOC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    230 (ALDOC)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     230 (ALDOC)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    230 (ALDOC)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    230 (ALDOC)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   230 (ALDOC)
SSDB
Motif
Pfam: Glycolytic
Other DBs
NCBI-GeneID: 230
NCBI-ProteinID: NP_005156
OMIM: 103870
HGNC: 418
Ensembl: ENSG00000109107
Pharos: P09972(Tbio)
UniProt: P09972 A0A024QZ64
Structure
LinkDB
Position
17:complement(28573120..28576895)
AA seq 364 aa
MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYR
QVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTD
GETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLARYASICQQ
NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHAC
PIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASFNLNAINRCPLPRPWALTF
SYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAAQGKYEGSGEDGGAAAQSLYIA
NHAY
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgcctcactcgtacccagccctttctgctgagcagaagaaggagttgtctgacattgcc
ctgcggattgtagccccgggcaaaggcattctggctgcggatgagtctgtaggcagcatg
gccaagcggctgagccaaattggggtggaaaacacagaggagaaccgccggctgtaccgc
caggtcctgttcagtgctgatgaccgtgtgaaaaagtgcattggaggcgtcattttcttc
catgagaccctctaccagaaagatgataatggtgttcccttcgtccgaaccatccaggat
aagggcatcgtcgtgggcatcaaggttgacaagggtgtggtgcctctagctgggactgat
ggagaaaccaccactcaagggctggatgggctctcagaacgctgtgcccaatacaagaag
gatggtgctgactttgccaagtggcgctgtgtgctgaaaatcagtgagcgtacaccctct
gcacttgccattctggagaacgccaacgtgctggcccgttatgccagtatctgccagcag
aatggcattgtgcctattgtggaacctgaaatattgcctgatggagaccacgacctcaaa
cgttgtcagtatgttacagagaaggtcttggctgctgtgtacaaggccctgagtgaccat
catgtatacctggaggggaccctgctcaagcccaacatggtgaccccgggccatgcctgt
cccatcaagtataccccagaggagattgccatggcaactgtcactgccctgcgtcgcact
gtgcccccagctgtcccaggagtgaccttcctgtctgggggtcagagcgaagaagaggca
tcattcaacctcaatgccatcaaccgctgcccccttccccgaccctgggcgcttaccttc
tcctatgggcgtgccctgcaagcctctgcactcaatgcctggcgagggcaacgggacaat
gctggggctgccactgaggagttcatcaagcgggctgaggtgaatgggcttgcagcccag
ggcaagtatgaaggcagtggagaagatggtggagcagcagcacagtcactctacattgcc
aaccatgcctactga

DBGET integrated database retrieval system