Homo sapiens (human): 22800 Help Entry 22800             CDS       T01001                                  Symbol RRAS2, NS12, TC21 Name (RefSeq) RAS related 2   KO K07830   Ras-related protein R-Ras2 Organism hsa  Homo sapiens (human) Pathway hsa04010   MAPK signaling pathway hsa04014   Ras signaling pathway hsa04024   cAMP signaling pathway hsa04072   Phospholipase D signaling pathway hsa04137   Mitophagy - animal hsa04140   Autophagy - animal hsa04218   Cellular senescence hsa04371   Apelin signaling pathway hsa04625   C-type lectin receptor signaling pathway hsa04810   Regulation of actin cytoskeleton hsa05205   Proteoglycans in cancer Disease H01738   Noonan syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     22800 (RRAS2)    04072 Phospholipase D signaling pathway     22800 (RRAS2)    04024 cAMP signaling pathway     22800 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     22800 (RRAS2)    04137 Mitophagy - animal     22800 (RRAS2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     22800 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     22800 (RRAS2)    04031 GTP-binding proteins [BR:hsa04031]     22800 (RRAS2) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    22800 (RRAS2)   Exosomal proteins of bladder cancer cells    22800 (RRAS2) GTP-binding proteins [BR:hsa04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     22800 (RRAS2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 SLFN-g3_helicase Motif Other DBs NCBI-GeneID:  22800 NCBI-ProteinID:  NP_036382 OMIM:  600098 HGNC:  17271 Ensembl:  ENSG00000133818 UniProt:  P62070 Structure PDBPDBj LinkDB All DBs Position 11:complement(14277920..14364506) Genome browser AA seq 204 aa AA seqDB search MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDR AARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEF PMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQE QECPPSPEPTRKEKDKKGCHCVIF NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggccgcggccggctggcgggacggctccggccaggagaagtaccggctcgtggtggtc ggcgggggcggcgtgggcaagtcggcgctcaccatccagttcatccagtcctattttgta acggattatgatccaaccattgaagattcttacacaaagcagtgtgtgatagatgacaga gcagcccggctagatattttggatacagcaggacaagaagagtttggagccatgagagaa cagtatatgaggactggcgaaggcttcctgttggtcttttcagtcacagatagaggcagt tttgaagaaatctataagtttcaaagacagattctcagagtaaaggatcgtgatgagttc ccaatgattttaattggtaataaagcagatctggatcatcaaagacaggtaacacaggaa gaaggacaacagttagcacggcagcttaaggtaacatacatggaggcatcagcaaagatt aggatgaatgtagatcaagctttccatgaacttgtccgggttatcaggaaatttcaagag caggaatgtcctccttcaccagaaccaacacggaaagaaaaagacaagaaaggctgccat tgtgtcattttctag

DBGET integrated database retrieval system