KEGG   Homo sapiens (human): 22829
Entry
22829             CDS       T01001                                 
Symbol
NLGN4Y, HNL4Y
Name
(RefSeq) neuroligin 4 Y-linked
  KO
K07378  neuroligin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    22829 (NLGN4Y)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    22829 (NLGN4Y)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    22829 (NLGN4Y)
SSDB
Motif
Pfam: COesterase BD-FAE Abhydrolase_3
Other DBs
NCBI-GeneID: 22829
NCBI-ProteinID: NP_055708
OMIM: 400028
HGNC: 15529
Ensembl: ENSG00000165246
Pharos: Q8NFZ3(Tbio)
UniProt: Q8NFZ3 A0A024R9E7
LinkDB
Position
Y:14522616..14845654
AA seq 816 aa
MLRPQGLLWLPLLFTSVCVMLNSNVLLWITALAIKFTLIDSQAQYPVVNTNYGKIQGLRT
PLPSEILGPVEQYLGVPYASPPTGERRFQPPESPSSWTGIRNATQFSAVCPQHLDERFLL
HDMLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDDIHEQNSKKPVMVYIHGGSYMEG
TGNMIDGSILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGA
FGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRIL
ADKVGCNMLDTTDMVECLKNKNYKELIQQTITPATYHIAFGPVIDGDVIPDDPQILMEQG
EFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETI
KFMYTDWADKENPETRRKTLVALFTDHQWVAPAVATADLHAQYGSPTYFYAFYHHCQSEM
KPSWADSAHGDEVPYVFGIPMIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPV
PQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNL
NEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAITPANNPKHSKDPHKTGPED
TTVLIETKRDYSTELSVTIAVGASLLFLNILAFAALYYKKDKRRHETHRHPSPQRNTTND
ITHIQNEEIMSLQMKQLEHDHECESLQAHDTLRLTCPPDYTLTLRRSPDDIPFMTPNTIT
MIPNTLMGMQPLHTFKTFSGGQNSTNLPHGHSTTRV
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgttgcgtccccagggactgctatggctccctttgttgttcacctctgtctgtgtcatg
ttaaactccaatgttcttctgtggataactgctcttgccatcaagttcaccctcattgac
agccaagcacagtatccagttgtcaacacaaattatggtaaaatccagggcctaagaaca
ccattacccagtgagatcttgggtccagtggagcagtacttaggggtcccctatgcctca
cccccaactggagagaggcggtttcagccaccagaatccccatcctcctggactggcatc
cgaaatgctactcagttttctgctgtgtgcccccagcacctggatgaaagattcttattg
catgacatgctgcccatctggtttaccaccagtttggatactttgatgacctatgttcaa
gatcaaaatgaagactgcctttacttaaacatctatgtgcccatggaagatgatattcat
gaacagaacagtaagaagcctgttatggtctatatccatgggggatcttacatggaggga
accggtaacatgattgatggcagcattttggccagctatgggaacgtcatcgttatcacc
attaactaccgtctgggaatactagggtttttaagtaccggtgaccaggcagcaaaaggc
aactatgggctcctggatcagattcaagcactgaggtggattgaggagaatgtcggagcc
tttggcggggaccccaagagagtgactatctttggctcgggggctggggcctcctgtgtc
agcctgttgaccctgtcccactactcagaaggtctcttccagaaggccatcattcagagc
ggcactgccctgtccagctgggcagtgaactaccagccggccaagtacactcggatattg
gcagacaaggtcggctgcaacatgctggacaccacggacatggtagaatgtctgaagaac
aagaactacaaggagctcatccagcagaccatcaccccggccacctaccacatagccttt
gggccggtgatcgacggcgacgtcatcccagacgacccccagatcctgatggagcaaggc
gagttcctcaactacgacatcatgctgggcgtcaaccaaggggaaggcctgaagttcgtg
gacggcatcgtggataacgaggacggtgtgacgcccaacgactttgacttctccgtgtcc
aacttcgtggacaacctttacggctaccctgaagggaaagacactttgcgggagactatc
aagttcatgtacacagactgggccgataaggaaaacccggagacgcggcggaaaaccctg
gtggctctctttactgaccatcagtgggtggcccccgccgtggccaccgccgacctgcac
gcgcagtacggctcccccacctacttctatgccttctatcatcactgccaaagcgaaatg
aagcccagctgggcagattcggcccatggcgatgaagtcccctatgtcttcggcatcccc
atgatcggtcccacagagctcttcagttgtaatttctccaagaacgacgtcatgctcagt
gccgtggtgatgacctactggacgaacttcgccaaaactggtgatccaaaccaaccagtt
cctcaggataccaagttcattcatacaaaacccaatcgctttgaagaagtggcctggtcc
aagtataatcccaaagaccagctctatctgcatattggcttgaaacccagagtgagagat
cactaccgggcaacgaaagtggctttctggttggaattggttcctcatttgcacaacttg
aacgagatattccagtatgtttcaacaaccacaaaggttcctccaccagacatgacatca
tttccctatggcacccggcgatctcccgccaagatatggccaaccaccaaacgcccagca
atcactcctgccaacaatcccaaacactctaaggaccctcacaaaacagggcccgaggac
acaactgtcctcattgaaaccaaacgagattattccaccgaattaagtgtcaccattgcc
gtcggggcgtcgctcctcttcctcaacatcttagcctttgcggcgctgtactacaaaaag
gacaagaggcgccatgagactcacaggcaccccagtccccagagaaacaccacaaatgat
atcactcacatccagaacgaagagatcatgtctctgcagatgaagcagctggaacacgat
cacgagtgtgagtcgctgcaggcacacgacacgctgaggctcacctgccctccagactac
accctcacgctgcgccggtcgccggatgacatcccatttatgacgccaaacaccatcacc
atgattccaaacacattgatggggatgcagcctttacacacttttaaaaccttcagtgga
ggacaaaacagtacaaatttaccccacggacattccaccactagagtatag

KEGG   Homo sapiens (human): 22871
Entry
22871             CDS       T01001                                 
Symbol
NLGN1, NL1
Name
(RefSeq) neuroligin 1
  KO
K07378  neuroligin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
Disease
H02111  Autism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    22871 (NLGN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    22871 (NLGN1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    22871 (NLGN1)
SSDB
Motif
Pfam: COesterase Abhydrolase_3 BD-FAE
Other DBs
NCBI-GeneID: 22871
NCBI-ProteinID: NP_055747
OMIM: 600568
HGNC: 14291
Ensembl: ENSG00000169760
Pharos: Q8N2Q7(Tbio)
UniProt: Q8N2Q7
Structure
LinkDB
Position
3:173395952..174294372
AA seq 823 aa
MALPRCTWPNYVWRAVMACLVHRGLGAPLTLCMLGCLLQAGHVLSQKLDDVDPLVATNFG
KIRGIKKELNNEILGPVIQFLGVPYAAPPTGERRFQPPEPPSPWSDIRNATQFAPVCPQN
IIDGRLPEVMLPVWFTNNLDVVSSYVQDQSEDCLYLNIYVPTEDDIRDSGGPKPVMVYIH
GGSYMEGTGNLYDGSVLASYGNVIVITVNYRLGVLGFLSTGDQAAKGNYGLLDLIQALRW
TSENIGFFGGDPLRITVFGSGAGGSCVNLLTLSHYSEGNRWSNSTKGLFQRAIAQSGTAL
SSWAVSFQPAKYARMLATKVGCNVSDTVELVECLQKKPYKELVDQDIQPARYHIAFGPVI
DGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFVENIVDSDDGISASDFDFAVSNFVD
NLYGYPEGKDVLRETIKFMYTDWADRHNPETRRKTLLALFTDHQWVAPAVATADLHSNFG
SPTYFYAFYHHCQTDQVPAWADAAHGDEVPYVLGIPMIGPTELFPCNFSKNDVMLSAVVM
TYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWTRYSQKDQLYLHIGLKPRVKEHYRA
NKVNLWLELVPHLHNLNDISQYTSTTTKVPSTDITFRPTRKNSVPVTSAFPTAKQDDPKQ
QPSPFSVDQRDYSTELSVTIAVGASLLFLNILAFAALYYKKDKRRHDVHRRCSPQRTTTN
DLTHAQEEEIMSLQMKHTDLDHECESIHPHEVVLRTACPPDYTLAMRRSPDDVPLMTPNT
ITMIPNTIPGIQPLHTFNTFTGGQNNTLPHPHPHPHSHSTTRV
NT seq 2472 nt   +upstreamnt  +downstreamnt
atggcactgcccagatgcacgtggccaaattatgtttggagagcagtgatggcatgcttg
gtacaccggggattgggtgccccattgactctctgtatgttgggatgtttgcttcaggct
ggccatgtgctatcacaaaaattggatgatgtggacccactggtggctaccaactttgga
aagataagagggattaagaaggaactcaataatgaaattttggggcctgttattcaattt
cttggggttccatatgcagccccaccaacaggggaacgtcgttttcagcctccagaacca
ccatctccctggtcagatatcagaaatgccactcaatttgctcctgtgtgtccccagaat
atcattgatggcagattgccagaagtcatgcttcctgtgtggtttactaataacttggat
gtggtttcatcatatgtgcaagaccagagcgaagactgcctatatttaaatatatatgtc
ccgactgaggatgatattcgggacagtgggggtcccaaaccagtgatggtgtatatccat
ggtggctcatatatggaaggtactggaaatttatatgatggaagtgtcttggcaagttat
ggcaatgtgatcgtcatcacagtcaactatcgacttggagtactcggtttcttgagtaca
ggcgatcaggctgcaaaggggaactatggactccttgatctcatacaagctttaagatgg
actagtgaaaacattggattctttggtggtgaccccttaagaatcactgtttttggatct
ggtgctgggggttcatgtgtcaacctgctgactttatcccattattctgaaggtaaccgt
tggagcaattcaaccaaaggactttttcaacgagcaatagctcaaagtggaacagccctt
tccagctgggctgttagttttcaacctgcaaaatatgctagaatgttggccacaaaagtt
ggttgcaatgtttcagatacagtagagttagtggaatgcctacagaagaagccttacaaa
gaacttgttgaccaagatattcaaccagctcgataccacatagcctttggacctgtgatt
gatggtgatgtaataccagacgacccccagatattgatggagcaaggagagtttctcaac
tatgatataatgttaggagtgaaccaaggggaagggttaaaatttgttgaaaatatagta
gatagcgatgatggtatatcagctagtgattttgactttgctgtttcaaattttgttgat
aatttatatggatatcctgaaggcaaagatgttttgagagaaaccattaagttcatgtat
actgactgggctgaccgtcataaccctgaaaccagaagaaagacattactggctttgttt
acggaccatcagtgggtggcaccagctgtagccacagcggatcttcactcaaactttggt
tcacctacgtacttctatgccttttaccatcattgccaaacagatcaggttccagcttgg
gctgatgcagcccacggagacgaggttccctatgtactgggaatccccatgattggccct
acagagttatttccttgcaatttctccaaaaatgatgtgatgctgagtgcagttgtaatg
acatactggacaaattttgctaaaactggtgacccaaatcaaccagtccctcaagacacg
aaattcattcataccaaacccaaccgttttgaagaagtagcatggaccagatattcccag
aaagaccaactttatctccatattggattaaaaccaagagttaaagaacattacagagcc
aataaggtgaacctctggttggagttggtacctcatctgcataatctcaatgacatttct
cagtatacctctacaacaactaaagtgccatcaactgacatcactttcagacctacgaga
aaaaattctgtacctgtcacgtcagcctttcccactgccaagcaggatgatcccaaacaa
caaccaagtccattttcagtggatcaaagggactactcaacagagctgagtgtcactatt
gcagttggagcatcactgctgtttctgaacatcttggcctttgcagccctgtactacaaa
aaggataagaggagacatgatgttcacaggagatgcagccctcagcgcactactaccaat
gatctaacccatgcacaagaagaggaaatcatgtccctccaaatgaagcacactgatttg
gatcatgaatgtgagtccattcatccacatgaggtggttcttcggaccgcctgtccccca
gattacacactagctatgaggaggtcacctgatgatgttcccttaatgacacccaacacc
attacaatgattcccaacactataccagggattcagcccttacacacattcaatacattt
actggaggacagaacaatactctgccccatccccatccccacccccattcacattcaaca
accagggtatag

KEGG   Homo sapiens (human): 54413
Entry
54413             CDS       T01001                                 
Symbol
NLGN3, HNL3
Name
(RefSeq) neuroligin 3
  KO
K07378  neuroligin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
Disease
H01882  Asperger syndrome
H02111  Autism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    54413 (NLGN3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    54413 (NLGN3)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    54413 (NLGN3)
SSDB
Motif
Pfam: COesterase BD-FAE Abhydrolase_3
Other DBs
NCBI-GeneID: 54413
NCBI-ProteinID: NP_851820
OMIM: 300336
HGNC: 14289
Ensembl: ENSG00000196338
Pharos: Q9NZ94(Tbio)
UniProt: Q9NZ94 X5DNV3
LinkDB
Position
X:71144841..71175307
AA seq 848 aa
MWLRLGPPSLSLSPKPTVGRSLCLTLWFLSLALRASTQAPAPTVNTHFGKLRGARVPLPS
EILGPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVMLP
VWFTANLDIVATYIQEPNEDCLYLNVYVPTEDVKRISKECARKPNKKICRKGGSGAKKQG
EDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITLNYRVG
VLGFLSTGDQAAKGNYGLLDQIQALRWVSENIAFFGGDPRRITVFGSGIGASCVSLLTLS
HHSEGLFQRAIIQSGSALSSWAVNYQPVKYTSLLADKVGCNVLDTVDMVDCLRQKSAKEL
VEQDIQPARYHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGVNQGEGLKFVEGVVDP
EDGVSGTDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADRDNPETRRKTLVALFTD
HQWVEPSVVTADLHARYGSPTYFYAFYHHCQSLMKPAWSDAAHGDEVPYVFGVPMVGPTD
LFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNKPVPQDTKFIHTKANRFEEVAWSKYNPRD
QLYLHIGLKPRVRDHYRATKVAFWKHLVPHLYNLHDMFHYTSTTTKVPPPDTTHSSHITR
RPNGKTWSTKRPAISPAYSNENAQGSWNGDQDAGPLLVENPRDYSTELSVTIAVGASLLF
LNVLAFAALYYRKDKRRQEPLRQPSPQRGAGAPELGAAPEEELAALQLGPTHHECEAGPP
HDTLRLTALPDYTLTLRRSPDDIPLMTPNTITMIPNSLVGLQTLHPYNTFAAGFNSTGLP
HSHSTTRV
NT seq 2547 nt   +upstreamnt  +downstreamnt
atgtggctgcggcttggcccgccctcgctgtccctgagccccaagcccacggttggcagg
agcctgtgcctcaccctgtggttcctcagtttggcgctgagggccagtacccaggcccca
gcacccacagtcaacactcactttgggaagctaaggggtgcccgagtaccactgcccagt
gagatcctggggcctgtggaccaatacctgggggtgccctacgcagctcccccgatcggc
gagaaacgtttcctgccccctgaaccacccccatcctggtcgggcatccggaacgccaca
cactttcccccagtgtgcccccagaacatccacacagctgtgcccgaagtcatgctgccg
gtctggttcactgccaacttggatatcgtcgctacttacatccaggagcccaacgaagac
tgtctctacctgaacgtctatgtgccgacggaggatgtaaagcggatttccaaggaatgc
gcccgaaagcccaacaagaaaatttgtaggaaaggaggatccggcgctaagaaacagggc
gaggacttagcggataatgacggggatgaagatgaagacatccgggacagtggtgctaaa
cccgtcatggtctacatccacggaggctcttacatggaagggacaggcaacatgattgat
ggcagcatcctcgccagttatggcaatgtcatcgtcatcaccctcaactatcgggttgga
gtgctaggtttcctgagtactggagatcaggctgccaagggcaactatgggctccttgac
cagatccaggccctccgctgggtgagcgagaatattgccttcttcgggggagacccccgc
cggatcactgtctttggctcgggcattggtgcatcctgcgtcagcctcctcacgttgtca
catcactcagagggacttttccagagagccatcatccaaagtggctctgctctgtccagc
tgggctgtgaactaccaaccagtgaagtacaccagcctgctggcagacaaagtgggctgt
aatgtgctggacaccgtggatatggtggactgtcttcggcaaaagagtgccaaggagctg
gtagagcaggacatccagccagcccgctaccacgtggcctttggccctgtgattgatggt
gatgtcattcctgatgaccctgagatcctcatggagcagggcgagttcctcaactatgac
atcatgctaggtgtcaaccagggcgagggtctcaagtttgtggaaggggtggtggaccct
gaggatggtgtctctggcactgactttgactattccgtctccaattttgtggacaatctg
tatggctatcctgagggtaaggacaccctgcgagagaccatcaagttcatgtatacagac
tgggcagaccgtgacaaccctgagacccgccgtaaaacactggtggcactcttcactgac
caccagtgggtggagccctcagtggtgacagccgatctgcatgcccgctacggctcgcct
acctacttctacgccttctatcatcactgccagagcctcatgaagcctgcttggtcagat
gcagctcatggggatgaagtaccctatgtttttggggttcctatggtaggccccactgac
cttttcccctgcaacttctccaagaatgatgttatgctcagtgctgtcgtcatgacctat
tggaccaactttgccaagactggggatcccaacaagccggtcccccaggacaccaagttc
attcacaccaaggccaaccgctttgaggaagtggcctggtccaaatacaatccccgagac
cagctctaccttcacatcgggctgaaaccaagggtccgagatcattaccgggccactaag
gtggccttttggaaacatctggtgccccacctatacaacctgcatgacatgttccactat
acgtccaccaccaccaaagtgccgcctccggataccacccacagctcccacatcacccgc
aggcccaatggcaagacctggagcaccaagcggccagccatctcacctgcctacagcaac
gagaatgcccaggggtcctggaacggggaccaggatgcagggccactcctggtggagaac
cctcgtgactactccactgaattaagtgtcaccatcgccgtgggggcctccctcctgttc
cttaacgttctggccttcgctgccctctactaccgtaaggacaaacggcgccaggagccc
ctgcggcagcctagccctcagcggggagccggggccccggagttgggagctgctccagag
gaggagctggcagcattacaactgggccccacccaccacgagtgtgaggccggtcccccc
catgacacgctgcgcctcactgcattgcccgactacaccctgaccctgcggcgctccccg
gatgacatcccactcatgacccccaacaccatcactatgatccccaactccctggtaggg
ctgcagacattgcacccctataacacctttgccgcagggttcaacagtaccgggctgccc
cactcacactccactacccgggtatag

KEGG   Homo sapiens (human): 57502
Entry
57502             CDS       T01001                                 
Symbol
NLGN4X, ASPGX2, AUTSX2, HLNX, HNL4X, NLGN4
Name
(RefSeq) neuroligin 4 X-linked
  KO
K07378  neuroligin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
Disease
H01882  Asperger syndrome
H02111  Autism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    57502 (NLGN4X)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    57502 (NLGN4X)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    57502 (NLGN4X)
SSDB
Motif
Pfam: COesterase BD-FAE Abhydrolase_3
Other DBs
NCBI-GeneID: 57502
NCBI-ProteinID: NP_001269074
OMIM: 300427
HGNC: 14287
Ensembl: ENSG00000146938
Pharos: Q8N0W4(Tbio)
UniProt: Q8N0W4 A0A024RBV0 B3KP11
Structure
LinkDB
Position
X:complement(5890042..6228867)
AA seq 816 aa
MSRPQGLLWLPLLFTPVCVMLNSNVLLWLTALAIKFTLIDSQAQYPVVNTNYGKIRGLRT
PLPNEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGIRNTTQFAAVCPQHLDERSLL
HDMLPIWFTANLDTLMTYVQDQNEDCLYLNIYVPTEDDIHDQNSKKPVMVYIHGGSYMEG
TGNMIDGSILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGA
FGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRIL
ADKVGCNMLDTTDMVECLRNKNYKELIQQTITPATYHIAFGPVIDGDVIPDDPQILMEQG
EFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETI
KFMYTDWADKENPETRRKTLVALFTDHQWVAPAVATADLHAQYGSPTYFYAFYHHCQSEM
KPSWADSAHGDEVPYVFGIPMIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPV
PQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNL
NEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAITPANNPKHSKDPHKTGPED
TTVLIETKRDYSTELSVTIAVGASLLFLNILAFAALYYKKDKRRHETHRRPSPQRNTTND
IAHIQNEEIMSLQMKQLEHDHECESLQAHDTLRLTCPPDYTLTLRRSPDDIPLMTPNTIT
MIPNTLTGMQPLHTFNTFSGGQNSTNLPHGHSTTRV
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgtcacggccccagggactgctatggcttcctttgttgttcaccccggtctgcgtcatg
ttaaactccaatgtcctcctgtggttaactgctcttgccatcaagttcaccctcattgac
agccaagcacagtatccagttgtcaacacaaattatggcaaaatccggggcctaagaaca
ccgttacccaatgagatcttgggtccagtggagcagtacttaggggtcccctatgcctca
ccccccactggagagaggcggtttcagcccccagaacccccgtcctcctggactggcatc
cgaaatactactcagtttgctgctgtgtgcccccagcacctggatgagagatccttactg
catgacatgctgcccatctggtttaccgccaatttggatactttgatgacctatgttcaa
gatcaaaatgaagactgcctttacttaaacatctacgtgcccacggaagatgatattcat
gatcagaacagtaagaagcccgtcatggtctatatccatgggggatcttacatggagggc
accggcaacatgattgacggcagcattttggcaagctacggaaacgtcatcgtgatcacc
attaactaccgtctgggaatactagggtttttaagtaccggtgaccaggcagcaaaaggc
aactatgggctcctggatcagattcaagcactgcggtggattgaggagaatgtgggagcc
tttggcggggaccccaagagagtgaccatctttggctcgggggctggggcctcctgtgtc
agcctgttgaccctgtcccactactcagaaggtctcttccagaaggccatcattcagagc
ggcaccgccctgtccagctgggcagtgaactaccagccggccaagtacactcggatattg
gcagacaaggtcggctgcaacatgctggacaccacggacatggtagaatgcctgcggaac
aagaactacaaggagctcatccagcagaccatcaccccggccacctaccacatagccttc
gggccggtgatcgacggcgacgtcatcccagacgacccccagatcctgatggagcaaggc
gagttcctcaactacgacatcatgctgggcgtcaaccaaggggaaggcctgaagttcgtg
gacggcatcgtggataacgaggacggtgtgacgcccaacgactttgacttctccgtgtcc
aacttcgtggacaacctttacggctaccctgaagggaaagacactttgcgggagactatc
aagttcatgtacacagactgggccgataaggaaaacccggagacgcggcggaaaaccctg
gtggctctctttactgaccaccagtgggtggcccccgccgtggccaccgccgacctgcac
gcgcagtacggctcccccacctacttctatgccttctatcatcactgccaaagcgaaatg
aagcccagctgggcagattcggcccatggtgatgaggtcccctatgtcttcggcatcccc
atgatcggtcccaccgagctcttcagttgtaacttttccaagaacgacgtcatgctcagc
gccgtggtcatgacctactggacgaacttcgccaaaactggtgatccaaatcaaccagtt
cctcaggataccaagttcattcacacaaaacccaaccgctttgaagaagtggcctggtcc
aagtataatcccaaagaccagctctatctgcatattggcttgaaacccagagtgagagat
cactaccgggcaacgaaagtggctttctggttggaactcgttcctcatttgcacaacttg
aacgagatattccagtatgtttcaacaaccacaaaggttcctccaccagacatgacatca
tttccctatggcacccggcgatctcccgccaagatatggccaaccaccaaacgcccagca
atcactcctgccaacaatcccaaacactctaaggaccctcacaaaacagggcctgaggac
acaactgtcctcattgaaaccaaacgagattattccaccgaattaagtgtcaccattgcc
gtcggggcgtcgctcctcttcctcaacatcttagcttttgcggcgctgtactacaaaaag
gacaagaggcgccatgagactcacaggcgccccagtccccagagaaacaccacaaatgat
atcgctcacatccagaacgaagagatcatgtctctgcagatgaagcagctggaacacgat
cacgagtgtgagtcgctgcaggcacacgacacactgaggctcacctgcccgccagactac
accctcacgctgcgccggtcgccagatgacatcccacttatgacgccaaacaccatcacc
atgattccaaacacactgacggggatgcagcctttgcacacttttaacaccttcagtgga
ggacaaaacagtacaaatttaccccacggacattccaccactagagtatag

KEGG   Homo sapiens (human): 57555
Entry
57555             CDS       T01001                                 
Symbol
NLGN2
Name
(RefSeq) neuroligin 2
  KO
K07378  neuroligin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    57555 (NLGN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    57555 (NLGN2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    57555 (NLGN2)
SSDB
Motif
Pfam: COesterase BD-FAE Abhydrolase_3 Peptidase_S9
Other DBs
NCBI-GeneID: 57555
NCBI-ProteinID: NP_065846
OMIM: 606479
HGNC: 14290
Ensembl: ENSG00000169992
Pharos: Q8NFZ4(Tbio)
UniProt: Q8NFZ4
Structure
LinkDB
Position
17:7404653..7419860
AA seq 835 aa
MWLLALCLVGLAGAQRGGGGPGGGAPGGPGLGLGSLGEERFPVVNTAYGRVRGVRRELNN
EILGPVVQFLGVPYATPPLGARRFQPPEAPASWPGVRNATTLPPACPQNLHGALPAIMLP
VWFTDNLEAAATYVQNQSEDCLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDPGKKPVM
LFLHGGSYMEGTGNMFDGSVLAAYGNVIVATLNYRLGVLGFLSTGDQAAKGNYGLLDQIQ
ALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSWSV
NYQPLKYTRLLAAKVGCDREDSAEAVECLRRKPSRELVDQDVQPARYHIAFGPVVDGDVV
PDDPEILMQQGEFLNYDMLIGVNQGEGLKFVEDSAESEDGVSASAFDFTVSNFVDNLYGY
PEGKDVLRETIKFMYTDWADRDNGEMRRKTLLALFTDHQWVAPAVATAKLHADYQSPVYF
YTFYHHCQAEGRPEWADAAHGDELPYVFGVPMVGATDLFPCNFSKNDVMLSAVVMTYWTN
FAKTGDPNQPVPQDTKFIHTKPNRFEEVVWSKFNSKEKQYLHIGLKPRVRDNYRANKVAF
WLELVPHLHNLHTELFTTTTRLPPYATRWPPRPPAGAPGTRRPPPPATLPPEPEPEPGPR
AYDRFPGDSRDYSTELSVTVAVGASLLFLNILAFAALYYKRDRRQELRCRRLSPPGGSGS
GVPGGGPLLPAAGRELPPEEELVSLQLKRGGGVGADPAEALRPACPPDYTLALRRAPDDV
PLLAPGALTLLPSGLGPPPPPPPPSLHPFGPFPPPPPTATSHNNTLPHPHSTTRV
NT seq 2508 nt   +upstreamnt  +downstreamnt
atgtggctcctggcgctgtgtctggtggggctggcgggggctcaacgcgggggagggggt
cccggcggcggcgccccgggcggccccggcctgggcctcggcagcctcggcgaggagcgc
ttcccggtggtgaacacggcctacgggcgagtgcgcggtgtgcggcgcgagctcaacaac
gagatcctgggccccgtcgtgcagttcttgggcgtgccctacgccacgccgcccctgggc
gcccgccgcttccagccgcctgaggcgcccgcctcgtggcccggcgtgcgcaacgccacc
accctgccgcccgcctgcccgcagaacctgcacggggcgctgcccgccatcatgctgcct
gtgtggttcaccgacaacttggaggcggccgccacctacgtgcagaaccagagcgaggac
tgcctgtacctcaacctctacgtgcccaccgaggacggtccgctcacaaaaaaacgtgac
gaggcgacgctcaatccgccagacacagatatccgtgaccctgggaagaagcctgtgatg
ctgtttctccatggcggctcctacatggaggggaccggaaacatgttcgatggctcagtc
ctggctgcctatggcaacgtcattgtagccacgctcaactaccgtcttggggtgctcggt
tttctcagcaccggggaccaggctgcaaaaggcaactatgggctcctggaccagatccag
gccctgcgctggctcagtgaaaacatcgcccactttgggggcgaccccgagcgtatcacc
atctttggttccggggcaggggcctcctgcgtcaaccttctgatcctctcccaccattca
gaagggctgttccagaaggccatcgcccagagtggcaccgccatttccagctggtctgtc
aactaccagccgctcaagtacacgcggctgctggcagccaaggtgggctgtgaccgagag
gacagcgctgaagctgtggagtgtctgcgccggaagccctcccgggagctggtggaccag
gacgtgcagcctgcccgctaccacatcgcctttgggcccgtggtggatggcgacgtggtc
cccgatgaccctgagatcctcatgcagcagggagaattcctcaactacgacatgctcatc
ggcgtcaaccagggagagggcctcaagttcgtggaggactctgcagagagcgaggacggt
gtgtctgccagcgcctttgacttcactgtctccaactttgtggacaacctgtatggctac
ccggaaggcaaggatgtgcttcgggagaccatcaagtttatgtacacagactgggccgac
cgggacaatggcgaaatgcgccgcaaaaccctgctggcgctctttactgaccaccaatgg
gtggcaccagctgtggccactgccaagctgcacgccgactaccagtctcccgtctacttt
tacaccttctaccaccactgccaggcggagggccggcctgagtgggcagatgcggcgcac
ggggatgaactgccctatgtctttggcgtgcccatggtgggtgccaccgacctcttcccc
tgtaacttctccaagaatgacgtcatgctcagtgccgtggtcatgacctactggaccaac
ttcgccaagactggggaccccaaccagccggtgccgcaggataccaagttcatccacacc
aagcccaatcgcttcgaggaggtggtgtggagcaaattcaacagcaaggagaagcagtat
ctgcacataggcctgaagccacgcgtgcgtgacaactaccgcgccaacaaggtggccttc
tggctggagctcgtgccccacctgcacaacctgcacacggagctcttcaccaccaccacg
cgcctgcctccctacgccacgcgctggccgcctcgtccccccgctggcgccccgggcaca
cgccggcccccgccgcctgccaccctgcctcccgagcccgagcccgagcccggcccaagg
gcctatgaccgcttccccggggactcacgggactactccacggagctgagcgtcaccgtg
gccgtgggtgcctccctcctcttcctcaacatcctggcctttgctgccctctactacaag
cgggaccggcggcaggagctgcggtgcaggcggcttagcccacctggcggctcaggctct
ggcgtgcctggtgggggccccctgctccccgccgcgggccgtgagctgccaccagaggag
gagctggtgtcactgcagctgaagcggggtggtggcgtcggggcggaccctgccgaggct
ctgcgccctgcctgcccgcccgactacaccctggccctgcgccgggcaccggacgatgtg
cctctcttggcccccggggccctgaccctgctgcccagtggcctggggccaccgccaccc
ccaccgcccccctcccttcatcccttcgggcccttccccccgccccctcccaccgccacc
agccacaacaacacgctaccccacccccactccaccactcgggtatag

DBGET integrated database retrieval system