KEGG   Homo sapiens (human): 22865
Entry
22865             CDS       T01001                                 
Symbol
SLITRK3
Name
(RefSeq) SLIT and NTRK like family member 3
  KO
K25834  SLIT and NTRK-like protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    22865 (SLITRK3)
SSDB
Motif
Pfam: LRR_8 LRR_5 LRR_4 LRR_9 LRRNT
Other DBs
NCBI-GeneID: 22865
NCBI-ProteinID: NP_001305739
OMIM: 609679
HGNC: 23501
Ensembl: ENSG00000121871
Pharos: O94933(Tbio)
UniProt: O94933
LinkDB
Position
3:complement(165186720..165197109)
AA seq 977 aa
MKPSIAEMLHRGRMLWIILLSTIALGWTTPIPLIEDSEEIDEPCFDPCYCEVKESLFHIH
CDSKGFTNISQITEFWSRPFKLYLQRNSMRKLYTNSFLHLNNAVSINLGNNALQDIQTGA
FNGLKILKRLYLHENKLDVFRNDTFLGLESLEYLQADYNVIKRIESGAFRNLSKLRVLIL
NDNLIPMLPTNLFKAVSLTHLDLRGNRLKVLFYRGMLDHIGRSLMELQLEENPWNCTCEI
VQLKSWLERIPYTALVGDITCETPFHFHGKDLREIRKTELCPLLSDSEVEASLGIPHSSS
SKENAWPTKPSSMLSSVHFTASSVEYKSSNKQPKPTKQPRTPRPPSTSQALYPGPNQPPI
APYQTRPPIPIICPTGCTCNLHINDLGLTVNCKERGFNNISELLPRPLNAKKLYLSSNLI
QKIYRSDFWNFSSLDLLHLGNNRISYVQDGAFINLPNLKSLFLNGNDIEKLTPGMFRGLQ
SLHYLYFEFNVIREIQPAAFSLMPNLKLLFLNNNLLRTLPTDAFAGTSLARLNLRKNYFL
YLPVAGVLEHLNAIVQIDLNENPWDCTCDLVPFKQWIETISSVSVVGDVLCRSPENLTHR
DVRTIELEVLCPEMLHVAPAGESPAQPGDSHLIGAPTSASPYEFSPPGGPVPLSVLILSL
LVLFFSAVFVAAGLFAYVLRRRRKKLPFRSKRQEGVDLTGIQMQCHRLFEDGGGGGGGSG
GGGRPTLSSPEKAPPVGHVYEYIPHPVTQMCNNPIYKPREEEEVAVSSAQEAGSAERGGP
GTQPPGMGEALLGSEQFAETPKENHSNYRTLLEKEKEWALAVSSSQLNTIVTVNHHHPHH
PAVGGVSGVVGGTGGDLAGFRHHEKNGGVVLFPPGGGCGSGSMLLDRERPQPAPCTVGFV
DCLYGTVPKLKELHVHPPGMQYPDLQQDARLKETLLFSAGKGFTDHQTQKSDYLELRAKL
QTKPDYLEVLEKTTYRF
NT seq 2934 nt   +upstreamnt  +downstreamnt
atgaaaccttccatagctgagatgcttcacagaggaaggatgttgtggataattcttcta
agcacaattgctctaggatggactaccccgattcccctaatagaggactcagaggaaata
gatgagccctgttttgatccatgctactgtgaagttaaagaaagcctctttcatatacat
tgtgacagtaaaggatttacaaatattagtcagattaccgagttctggtcaagacctttt
aaactgtatctgcagaggaattctatgaggaaattatataccaacagttttcttcatttg
aataatgctgtgtctattaatcttgggaacaatgcattgcaggacattcagactggagct
ttcaatggtcttaagattttaaagagactatatctacatgaaaacaaactagatgtcttc
agaaatgacaccttccttggcttggaaagtctagaatatctgcaggcagattacaatgtc
attaaacgtattgagagtggggcatttcggaacctaagtaaattgagggttctgatttta
aatgataatctcatccccatgcttccaaccaatttatttaaggctgtctctttaacccat
ttggacctacgtggaaataggttaaaggttcttttttaccgaggaatgctagatcacatt
ggcagaagcctgatggagctccagctggaagaaaacccttggaactgtacatgtgaaatt
gtacaactgaagagttggctggaacgcattccttatactgccctggtgggagacattacc
tgtgagacccctttccacttccatggaaaggacctacgagaaatcaggaagacagaactc
tgtcccttgttgtctgactctgaggtagaggctagtttgggaattccacattcgtcatca
agtaaggagaatgcatggccaactaagccttcctcaatgctatcctctgttcattttact
gcttcttctgtcgaatacaagtcctcaaataaacagcctaagcccaccaaacagcctcga
acaccaaggccaccctccacctcccaagctttatatcctggtccaaaccagcctcccatt
gctccttatcagaccagaccaccaatccccattatatgccccactgggtgtacctgtaat
ttgcacatcaatgaccttggcttgactgtcaactgcaaagagcgaggatttaataacatt
tctgaacttcttccaaggcccttgaatgccaagaaactgtatctgagtagcaatctgatt
cagaaaatataccgttctgatttttggaatttttcttccttggatctcttgcatctgggg
aacaatcgtatttcctatgtccaagatggggcctttatcaacttgcccaacttaaagagc
ctcttccttaatggcaacgatatagagaagctgacaccaggcatgttccgaggcctacag
agtttgcactacttgtactttgagttcaatgtcatccgggaaatccagcctgcagccttc
agcctcatgcccaacttgaagctgctattcctcaataataacttactgaggactctgcca
acagacgcctttgctggcacatccctggcccggctcaacctgaggaagaactacttcctc
tatcttcccgtggctggtgtcctggaacacttgaatgccattgtccagatagacctcaat
gagaatccttgggactgcacctgtgacctggtcccctttaaacagtggatcgaaaccatc
agctcagtcagtgtggttggtgatgtgctttgcaggagccctgagaacctcacgcaccgt
gatgtgcgcactattgagctggaagttctttgcccagagatgctgcacgttgcaccagct
ggagaatccccagcccagcctggagattctcaccttattggggcaccaaccagtgcatca
ccttatgagttttctcctcctgggggccctgtgccactttctgtgttaattctcagcctg
ctggttctgtttttctcagcagtctttgttgctgcaggcctctttgcctacgtgctccga
aggcgtcgaaagaagctgcccttcagaagcaagcggcaggaaggtgtggaccttactggc
atccaaatgcaatgccacaggctgtttgaggatggtggaggtggtggtggcggaagtggg
ggtggtggtcgaccaactctttcctctccagagaaggcccctcccgtgggtcatgtgtat
gagtacatcccccacccggttacccaaatgtgcaacaaccccatctacaagcctcgtgag
gaggaggaggtggctgtttcatcagcccaagaagcagggagtgcagaacgtgggggtcca
gggacacaaccaccgggaatgggtgaggctctcctaggaagtgagcagtttgctgagaca
cccaaggagaaccatagtaactaccggaccttgctggaaaaagagaaggagtgggcccta
gcagtgtccagctcccagcttaacaccatagtgacggtgaatcaccatcaccctcaccac
ccagcagttggtggggtttcaggagtagttgggggaactgggggagacttggcagggttc
cgccaccatgagaaaaatggtggggtggtgctgtttcctcctgggggaggctgtggtagt
ggcagtatgctactagatcgagagaggccacagcctgccccctgcacagtgggatttgtg
gactgtctctatggaacagtgcccaaattaaaggaactgcacgtgcaccctcctggcatg
caatacccagacttacagcaggatgccaggctcaaagaaacccttctcttctcggctgga
aagggcttcacagaccaccaaacccaaaaaagtgattacctcgagttaagggccaaactt
caaaccaagccggattacctcgaagtcctggagaagacaacatacaggttctaa

DBGET integrated database retrieval system