KEGG   Homo sapiens (human): 22888
Entry
22888             CDS       T01001                                 
Symbol
UBOX5, RNF37, UBCE7IP5, UIP5, hUIP5
Name
(RefSeq) U-box domain containing 5
  KO
K10600  U-box domain-containing protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    22888 (UBOX5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    22888 (UBOX5)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  U-box type E3
   22888 (UBOX5)
SSDB
Motif
Pfam: DUF5918 U-box zf-RING_5 Prok-RING_4 zf-RING_UBOX zf-C3HC4_3 zf-C3HC4
Other DBs
NCBI-GeneID: 22888
NCBI-ProteinID: NP_055763
OMIM: 619675
HGNC: 17777
Ensembl: ENSG00000185019
Pharos: O94941(Tbio)
UniProt: O94941
LinkDB
Position
20:complement(3107573..3159865)
AA seq 541 aa
MVINLCLPQFRPRIHCNKISADGYEVENLISEDLTKRSHGFRTEYFIKPPVYVTVSFPFN
VEICRINIDLTAGGGQNVTGLEMYTSASSSRVSWNTPQCRTLGPAEPSVPDKEAFTLVGK
VLLKNQSQVVFSHRGFKARPPFGAMEATLPSPAVVAQELWNKGALSLSHVAHLRICITHV
TGGGIPCIKRLEVWGQPAKTCSQEVIDSILLVTSENLPQDVALQAPALPMESDCDPGDQP
ESQQAPSSLQKLAEIIQDVPEEFLDPITLEIMPCPMLLPSGKVIDQSTLEKCNRSEATWG
RVPSDPFTGVAFTPHSQPLPHPSLKARIDHFLLQHSIPGCHLLGRAQTALAVIPSSIVLP
SQKRKIEQAEHVPDSNFGVNASCFSATSPLVLPTTSEHTAKKMKATNEPSLTHMDCSTGP
LSHEQKLSQSLEIALASTLGSMPSFTARLTRGQLQHLGTRGSNTSWRPGTGSEQPGSILG
PECASCKRVFSPYFKKEPVYQLPCGHLLCRPCLGEKQRSLPMTCTACQRPVASQDVLRVH
F
NT seq 1626 nt   +upstreamnt  +downstreamnt
atggtaataaatctttgcctcccacagttcagaccaagaattcactgcaacaagatatca
gctgatggttacgaagtagaaaatctcatctctgaagatctcacaaagagaagtcatggt
ttcaggacagagtatttcattaagccaccagtctatgtgacagtttcatttccctttaat
gtggaaatctgtaggatcaacatagacctcacagctgggggaggtcagaacgtcactggc
ctggaaatgtacacatctgcctcatctagcagagtgtcttggaatacgccccagtgccgg
accctgggcccagctgagccatctgtcccagacaaggaggcgttcaccttggtaggcaaa
gtcttactgaaaaaccagagccaagtggtgtttagccacaggggcttcaaggccaggccc
ccttttggcgcgatggaagccacactcccctcccctgctgttgtggcccaggagctctgg
aataaaggggctctttcccttagccacgtggcccacttaaggatctgtatcacccatgtg
acaggcggcggtatcccttgtatcaagcggttggaagtgtggggtcagccggccaagacc
tgctcccaggaagtgatagacagcatcctgctggtcacctcagagaacctgcctcaggat
gtggctctgcaggctccagccttgcccatggaaagtgactgtgaccctggggaccagcct
gagagccagcaggctccctccagcctgcagaagctggccgagatcattcaggatgtgcct
gaggagttcctggatcccatcaccctggagatcatgccttgtcccatgctgctgccctca
ggcaaggtcatcgaccagagcacactggagaagtgtaaccgcagtgaagccacatggggc
cgagtgcccagtgaccctttcacgggggtagcttttactccgcactctcagcccctgcct
cacccctccctcaaggcccggattgaccatttcctgctccagcactccatccctggctgc
cacctgcttgggagagcacagacggcattggcagtgatcccttcttccattgttctgccc
tctcagaaaaggaagatagagcaggctgaacatgtcccagacagtaactttggtgtaaat
gcttcctgtttttctgccacaagccctttggtcttacccactacctcagagcacactgct
aagaaaatgaaagccaccaatgagcccagcctgacacatatggactgctcgacaggtcca
ctgtcccacgagcagaagctgtcacaaagcttggaaattgccttggcatccacccttggc
tctatgccctccttcacggcacggctgaccaggggacagctccagcaccttggcacaaga
gggagcaacacttcctggaggcctggcaccggctcggagcagcctgggagcatcctgggc
cccgaatgtgcctcctgcaaaagagtattttctccctacttcaaaaaggagccggtgtac
cagctgccctgcggccacctcctgtgccgaccctgcctgggtgagaagcaacgctccctg
cccatgacgtgcacagcctgccagcggccggttgctagccaagacgtgctgcgggtccac
ttctga

DBGET integrated database retrieval system