KEGG   Homo sapiens (human): 22987
Entry
22987             CDS       T01001                                 
Symbol
SV2C, SLC22B3
Name
(RefSeq) synaptic vesicle glycoprotein 2C
  KO
K06258  MFS transporter, VNT family, synaptic vesicle glycoprotein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04512  ECM-receptor interaction
Drug target
Padsevonil: D11842
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    22987 (SV2C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    22987 (SV2C)
Transporters [BR:hsa02000]
 Major facilitator superfamily (MFS)
  Protein transporters
   Vesicular neurotransmitter transporter (VNT) [TC:2.A.1.22]
    22987 (SV2C)
SSDB
Motif
Pfam: MFS_1 Sugar_tr Pentapeptide_4 Pentapeptide_3
Other DBs
NCBI-GeneID: 22987
NCBI-ProteinID: NP_055794
OMIM: 610291
HGNC: 30670
Ensembl: ENSG00000122012
Pharos: Q496J9(Tbio)
UniProt: Q496J9 B3KT41
Structure
LinkDB
Position
5:75847464..76353939
AA seq 727 aa
MEDSYKDRTSLMKGAKDIAREVKKQTVKKVNQAVDRAQDEYTQRSYSRFQDEEDDDDYYP
AGETYNGEANDDEGSSEATEGHDEDDEIYEGEYQGIPSMNQAKDSIVSVGQPKGDEYKDR
RELESERRADEEELAQQYELIIQECGHGRFQWALFFVLGMALMADGVEVFVVGFVLPSAE
TDLCIPNSGSGWLGSIVYLGMMVGAFFWGGLADKVGRKQSLLICMSVNGFFAFLSSFVQG
YGFFLFCRLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAMAWAI
IPHYGWSFSMGSAYQFHSWRVFVIVCALPCVSSVVALTFMPESPRFLLEVGKHDEAWMIL
KLIHDTNMRARGQPEKVFTVNKIKTPKQIDELIEIESDTGTWYRRCFVRIRTELYGIWLT
FMRCFNYPVRDNTIKLTIVWFTLSFGYYGLSVWFPDVIKPLQSDEYALLTRNVERDKYAN
FTINFTMENQIHTGMEYDNGRFIGVKFKSVTFKDSVFKSCTFEDVTSVNTYFKNCTFIDT
VFDNTDFEPYKFIDSEFKNCSFFHNKTGCQITFDDDYSAYWIYFVNFLGTLAVLPGNIVS
ALLMDRIGRLTMLGGSMVLSGISCFFLWFGTSESMMIGMLCLYNGLTISAWNSLDVVTVE
LYPTDRRATGFGFLNALCKAAAVLGNLIFGSLVSITKSIPILLASTVLVCGGLVGLCLPD
TRTQVLM
NT seq 2184 nt   +upstreamnt  +downstreamnt
atggaagactcttacaaggataggacttcactgatgaagggtgccaaggacattgccaga
gaggtgaagaaacaaacagtaaagaaggtgaatcaagctgtggaccgagcccaggatgaa
tacacccagaggtcctacagtcggttccaagatgaagaagatgatgatgactactacccg
gctggagaaacctataatggtgaggccaacgatgacgaaggctcaagtgaagccactgag
gggcatgatgaagatgatgagatctatgagggggagtatcagggcatccccagtatgaac
caagcgaaggacagcatcgtgtcagtggggcagcccaagggcgatgagtacaaggaccgg
cgggagctggaatcagaaaggagagctgacgaggaagagttagcccagcagtatgagctg
ataatccaagaatgcggtcatggtcgttttcagtgggcccttttcttcgtcctgggcatg
gctcttatggcagacggtgtagaggtgtttgtcgttggcttcgtgttacccagtgctgag
acagacctctgcatcccaaattcaggatctggatggctaggcagcatagtgtacctcggg
atgatggtgggggcgttcttctggggaggactggcagacaaagtgggaaggaaacagtct
cttctgatttgcatgtctgtcaacggattctttgccttcctttcttcatttgtccaaggt
tatggcttctttctcttctgtcgcttactttctggattcgggattggaggagccataccc
actgtgttctcgtactttgctgaagtcctggcccgggaaaagcggggcgaacacttgagc
tggctctgcatgttctggatgatcggtggcatctacgcctctgccatggcctgggccatc
atcccgcactacgggtggagcttcagcatgggatcggcctaccagtttcacagttggcgt
gtgtttgtcatcgtctgtgcactcccctgtgtctcctccgtggtggccctcacattcatg
cctgaaagcccacgattcttgttggaggttggaaaacatgatgaagcttggatgattctg
aagttaattcatgacaccaacatgagagcccggggtcagcctgagaaggtcttcacggta
aacaaaataaaaactcctaaacaaatagatgagctgattgaaattgagagtgacacagga
acatggtataggaggtgttttgttcggatccgcaccgagctgtacggaatttggttgact
tttatgagatgtttcaactacccagtcagggataatacaataaagcttacaattgtttgg
ttcaccctgtcctttgggtactatggattatccgtttggttccctgatgtcattaaacct
ctgcagtccgatgaatatgcattgctaaccagaaatgtggagagagataaatatgcaaat
ttcactattaactttacaatggaaaatcagattcatactggaatggaatacgacaatggc
agattcataggggtcaagttcaaatctgtaactttcaaagactctgtttttaagtcctgc
acctttgaggatgtaacttcagtgaacacctacttcaagaactgcacatttattgacact
gtttttgacaacacagattttgagccatataaattcattgacagtgaatttaaaaactgc
tcgttttttcacaacaagacgggatgtcagattacctttgatgatgactatagtgcctac
tggatttattttgtcaactttctggggacattggcagtattgccagggaacattgtgtct
gctctgctgatggacagaattgggcgcttaacaatgctaggtggctctatggtgctttcg
gggatcagctgtttcttcctttggttcggcaccagtgaatccatgatgataggcatgctg
tgtctgtacaatggattgaccatctcagcctggaactctcttgacgtggtcactgtggaa
ctgtaccccacagaccggagggcaacaggctttggcttcttaaatgcgctatgcaaggca
gcagccgtcctgggaaacttaatatttggctctctggtcagcatcaccaaatcaatcccc
atcctgctggcttctactgtgctcgtgtgtggaggactcgttgggctgtgcctgcctgac
acacgaacccaggttctgatgtaa

DBGET integrated database retrieval system