KEGG   Homo sapiens (human): 230Help
Entry
230               CDS       T01001                                 

Gene name
ALDOC, ALDC
Definition
(RefSeq) aldolase, fructose-bisphosphate C
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00030  Pentose phosphate pathway
hsa00051  Fructose and mannose metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    230 (ALDOC)
   00030 Pentose phosphate pathway
    230 (ALDOC)
   00051 Fructose and mannose metabolism
    230 (ALDOC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    230 (ALDOC)
   03036 Chromosome and associated proteins [BR:hsa03036]
    230 (ALDOC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    230 (ALDOC)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     230 (ALDOC)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    230 (ALDOC)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    230 (ALDOC)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   230 (ALDOC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 230
NCBI-ProteinID: NP_005156
OMIM: 103870
HGNC: 418
Ensembl: ENSG00000109107
Vega: OTTHUMG00000132605
Pharos: P09972(Tbio)
UniProt: P09972 A0A024QZ64
LinkDB All DBs
Structure
PDB: 

Position
17q11.2
AA seq 364 aa AA seqDB search
MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYR
QVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTD
GETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLARYASICQQ
NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHAC
PIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASFNLNAINRCPLPRPWALTF
SYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAAQGKYEGSGEDGGAAAQSLYIA
NHAY
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcctcactcgtacccagccctttctgctgagcagaagaaggagttgtctgacattgcc
ctgcggattgtagccccgggcaaaggcattctggctgcggatgagtctgtaggcagcatg
gccaagcggctgagccaaattggggtggaaaacacagaggagaaccgccggctgtaccgc
caggtcctgttcagtgctgatgaccgtgtgaaaaagtgcattggaggcgtcattttcttc
catgagaccctctaccagaaagatgataatggtgttcccttcgtccgaaccatccaggat
aagggcatcgtcgtgggcatcaaggttgacaagggtgtggtgcctctagctgggactgat
ggagaaaccaccactcaagggctggatgggctctcagaacgctgtgcccaatacaagaag
gatggtgctgactttgccaagtggcgctgtgtgctgaaaatcagtgagcgtacaccctct
gcacttgccattctggagaacgccaacgtgctggcccgttatgccagtatctgccagcag
aatggcattgtgcctattgtggaacctgaaatattgcctgatggagaccacgacctcaaa
cgttgtcagtatgttacagagaaggtcttggctgctgtgtacaaggccctgagtgaccat
catgtatacctggaggggaccctgctcaagcccaacatggtgaccccgggccatgcctgt
cccatcaagtataccccagaggagattgccatggcaactgtcactgccctgcgtcgcact
gtgcccccagctgtcccaggagtgaccttcctgtctgggggtcagagcgaagaagaggca
tcattcaacctcaatgccatcaaccgctgcccccttccccgaccctgggcgcttaccttc
tcctatgggcgtgccctgcaagcctctgcactcaatgcctggcgagggcaacgggacaat
gctggggctgccactgaggagttcatcaagcgggctgaggtgaatgggcttgcagcccag
ggcaagtatgaaggcagtggagaagatggtggagcagcagcacagtcactctacattgcc
aaccatgcctactga

DBGET integrated database retrieval system