KEGG   Homo sapiens (human): 23085
Entry
23085             CDS       T01001                                 
Symbol
ERC1, Cast2, ELKS, ERC-1, RAB6IP2
Name
(RefSeq) ELKS/RAB6-interacting/CAST family member 1
  KO
K16072  ELKS/RAB6-interacting/CAST family member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    23085 (ERC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23085 (ERC1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Others
   Others
    23085 (ERC1)
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    23085 (ERC1)
SSDB
Motif
Pfam: Cast RBD-FIP Crescentin ATG16 GAS AAA_13 Fez1 PKcGMP_CC DUF5486
Other DBs
NCBI-GeneID: 23085
NCBI-ProteinID: NP_829884
OMIM: 607127
HGNC: 17072
Ensembl: ENSG00000082805
Pharos: Q8IUD2(Tbio)
UniProt: Q8IUD2
LinkDB
Position
12:989959..1495933
AA seq 1116 aa
MYGSARSVGKVEPSSQSPGRSPRLPRSPRLGHRRTNSTGGSSGSSVGGGSGKTLSMENIQ
SLNAAYATSGPMYLSDHENVGSETPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVAS
DTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLS
SSMNSIKTFWSPELKKERALRKDEASKITIWKEQYRVVQEENQHMQMTIQALQDELRIQR
DLNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKELFLLRKTLEEMELRIETQKQ
TLNARDESIKKLLEMLQSKGLSAKATEEDHERTRRLAEAEMHVHHLESLLEQKEKENSML
REEMHRRFENAPDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLKSNGALSTEERE
EEMKQMEVYRSHSKFMKNKVEQLKEELSSKEAQWEELKKKAAGLQAEIGQVKQELSRKDT
ELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNK
KTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKER
VKSLQADTTNTDTALTTLEEALAEKERTIERLKEQRDRDEREKQEEIDNYKKDLKDLKEK
VSLLQGDLSEKEASLLDLKEHASSLASSGLKKDSRLKTLEIALEQKKEECLKMESQLKKA
HEAALEARASPEMSDRIQHLEREITRYKDESSKAQAEVDRLLEILKEVENEKNDKDKKIA
ELERQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDNLNDSSQQLQDSLRKKDDRIE
ELEEALRESVQITAEREMVLAQEESARTNAEKQVEELLMAMEKVKQELESMKAKLSSTQQ
SLAEKETHLTNLRAERRKHLEEVLEMKQEALLAAISEKDANIALLELSSSKKKTQEEVAA
LKREKDRLVQQLKQQTQNRMKLMADNYEDDHFKSSHSNQTNHKPSPDQIIQPLLELDQNR
SKLKLYIGHLTTLCHDRDPLILRGLTPPASYNLDDDQAAWENELQKMTRGQLQDELEKGE
RDNAELQEFANAILQQIADHCPDILEQVVNALEESS
NT seq 3351 nt   +upstreamnt  +downstreamnt
atgtatggaagtgcccgctctgttgggaaggtggagccgagcagccagagccctgggcgt
tcacccaggcttccacgttcccctcgcttgggtcaccgtcgaaccaacagtacgggaggg
agttcgggaagcagtgttggaggtggcagtgggaaaaccctttcaatggaaaatatacaa
tctttaaatgctgcctatgccacctctggccctatgtatctaagtgaccatgaaaatgtg
ggttcagaaacacctaaaagcaccatgacacttggccgttctgggggacgtctgccttac
ggtgttcggatgactgctatgggtagtagccccaatatagctagcagtggggttgctagt
gacaccatagcatttggagagcatcacctccctcctgtgagtatggcatccactgtacct
cactcccttcgtcaggcgagagataacacaatcatggatctgcagacacagctgaaggaa
gtattaagagaaaatgatctcttgcggaaggatgtggaagtaaaggagagcaaattgagt
tcttcaatgaatagcatcaagaccttctggagcccagagctgaagaaggaacgagccctg
agaaaagatgaagcttccaaaatcaccatttggaaggaacagtacagagttgtacaggag
gaaaaccagcacatgcagatgacaatccaggctctccaggatgaattgcggatccagagg
gacctgaatcagctgtttcagcaggatagtagcagcaggactggcgaaccttgtgtagca
gagctgacagaggagaactttcagaggcttcatgctgagcatgagcggcaggccaaagag
ctgtttcttcttcgaaagacattggaggaaatggagctgcgtattgagactcaaaagcag
accctaaatgctcgggatgaatccattaagaagcttctggaaatgttgcagagcaaagga
ctttctgccaaggctaccgaggaagaccatgagagaacaagacgactggcagaggcagag
atgcacgttcatcacctagaaagccttttggagcagaaggaaaaagagaacagtatgttg
agagaggagatgcatcgaaggtttgagaatgctcctgattctgccaaaacaaaagctctg
caaactgttattgagatgaaggattcaaaaatttcctctatggagcgtgggcttcgagac
ctggaagaggaaattcagatgctgaaatcgaatggtgctttgagtactgaggaaagggaa
gaagaaatgaagcaaatggaagtgtatcggagccattctaaatttatgaaaaataaggta
gaacaactgaaggaggaactaagttcgaaagaggctcaatgggaggagctgaaaaagaaa
gcggctggtcttcaggctgagattggccaggtgaaacaggagctgtccagaaaggacaca
gaactactcgccctgcagacaaagctagaaacactcacaaaccagttctcagatagtaaa
cagcacattgaagtgttgaaggagtccttgactgctaaggagcagagggctgccatcctg
cagactgaggtggatgctctccgattgcgtttggaagagaaggaaaccatgttgaataaa
aagacaaaacaaattcaggatatggctgaagagaaggggacacaagctggagagatacat
gacctcaaggacatgttggatgtgaaggagcggaaggttaatgttcttcagaagaagatt
gaaaatcttcaagagcagcttagagacaaggaaaagcagatgagcagcttgaaagaacgg
gtcaaatccttgcaggctgacaccaccaacactgacactgccttgacaactttggaggag
gcccttgcagagaaagagcggacaattgaacgcttaaaggagcagagggacagagatgag
cgagagaagcaagaggaaattgataactacaaaaaagatcttaaagacttgaaggaaaaa
gtcagcctgttgcaaggcgacctttcagagaaagaggcttcacttttggatctgaaagag
catgcttcttctctggcatcctcaggactgaaaaaggactcacggcttaagacactagag
attgctttggagcagaagaaggaggagtgtctgaaaatggaatcacaattgaaaaaggca
catgaggcagcattggaagccagagccagtccagagatgagtgaccgaatacagcacttg
gagagagagatcaccaggtacaaagatgaatctagcaaggcccaggcagaagttgatcga
ctcttagaaatcttgaaggaggtggaaaatgagaagaatgacaaagataagaagatagct
gagttggaaaggcaagtgaaagaccagaataagaaggtagcaaatctgaagcacaaggaa
caggtggaaaaaaagaagagtgcacaaatgttagaggaggcgcgacgacgggaggacaat
ctcaacgacagctctcagcagctacaggacagtctccgtaagaaggatgacaggattgaa
gagctggaagaagcactaagagaaagtgtacagataactgcagagcgggaaatggtgcta
gcacaagaggaatcagccaggaccaatgctgaaaaacaggtggaggagttactgatggcc
atggagaaggtaaagcaggaactagaatccatgaaagcaaagctgtcctccacccagcag
tctctggcagaaaaggaaactcacttgactaatcttcgggcagagagaaggaaacactta
gaggaagttctggagatgaagcaagaagctcttctggctgccattagtgaaaaagacgcc
aatatagctctcttggagctttcgtcctctaagaagaagacccaagaggaagtggctgcc
ctgaagcgggagaaggatcgtctggtacagcagcttaagcagcagacgcaaaatcgaatg
aagctaatggccgacaactacgaggatgaccacttcaaatcctcccattccaatcaaaca
aatcacaagccctccccagaccagatcatccagcccctcttagaacttgaccaaaataga
agtaaattaaagttgtacattggacacctgacaaccctctgccatgaccgagaccccctg
atcctccgtggactcactccaccagcttcctataacttggacgatgaccaggcggcttgg
gagaatgagctgcagaagatgacccgggggcagcttcaggatgagttagagaaaggtgaa
cgggacaatgcagaactgcaggagtttgccaacgccattcttcagcagatagcagaccat
tgtcccgacatcctagagcaagtggtcaacgccctggaagagtcctcttga

DBGET integrated database retrieval system