KEGG   Homo sapiens (human): 23237
Entry
23237             CDS       T01001                                 
Symbol
ARC, Arg3.1, hArc
Name
(RefSeq) activity regulated cytoskeleton associated protein
  KO
K15867  activity-regulated cytoskeleton-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05031  Amphetamine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09165 Substance dependence
   05031 Amphetamine addiction
    23237 (ARC)
SSDB
Motif
Pfam: Arc_MA Arc_C Retrotrans_gag Ty3_capsid DUF842 DUF3583
Other DBs
NCBI-GeneID: 23237
NCBI-ProteinID: NP_056008
OMIM: 612461
HGNC: 648
Ensembl: ENSG00000198576
Pharos: Q7LC44(Tbio)
UniProt: Q7LC44
Structure
LinkDB
Position
8:complement(142611049..142614479)
AA seq 396 aa
MELDHRTSGGLHAYPGPRGGQVAKPNVILQIGKCRAEMLEHVRRTHRHLLAEVSKQVERE
LKGLHRSVGKLESNLDGYVPTSDSQRWKKSIKACLCRCQETIANLERWVKREMHVWREVF
YRLERWADRLESTGGKYPVGSESARHTVSVGVGGPESYCHEADGYDYTVSPYAITPPPAA
GELPGQEPAEAQQYQPWVPGEDGQPSPGVDTQIFEDPREFLSHLEEYLRQVGGSEEYWLS
QIQNHMNGPAKKWWEFKQGSVKNWVEFKKEFLQYSEGTLSREAIQRELDLPQKQGEPLDQ
FLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRFLRHPLPKTLEQLIQRGMEVQDDLE
QAAEPAGPHLPVEDEAETLTPAPNSESVASDRTQPE
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggagctggaccaccggaccagcggcgggctccacgcctaccccgggccgcggggcggg
caggtggccaagcccaacgtgatcctgcagatcgggaagtgccgggccgagatgctggag
cacgtgcggcggacgcaccggcacctgctggccgaggtgtccaagcaggtggagcgcgag
ctgaaggggctgcaccggtcggtcgggaagctggagagcaacctggacggctacgtgccc
acgagcgactcgcagcgctggaagaagtccatcaaggcctgcctgtgccgctgccaggag
accatcgccaacctggagcgctgggtcaagcgcgagatgcacgtgtggcgcgaggtgttc
taccgcctggagcgctgggccgaccgcctggagtccacgggcggcaagtacccggtgggc
agcgagtcagcccgccacaccgtttccgtgggcgtggggggtcccgagagctactgccac
gaggcagacggctacgactacaccgtcagcccctacgccatcaccccgcccccagccgct
ggcgagctgcccgggcaggagcccgccgaggcccagcagtaccagccgtgggtccccggc
gaggacgggcagcccagccccggcgtggacacgcagatcttcgaggaccctcgagagttc
ctgagccacctagaggagtacttgcggcaggtgggcggctctgaggagtactggctgtcc
cagatccagaatcacatgaacgggccggccaagaagtggtgggagttcaagcagggctcc
gtgaagaactgggtggagttcaagaaggagttcctgcagtacagcgagggcacgctgtcc
cgagaggccatccagcgcgagctggacctgccgcagaagcagggcgagccgctggaccag
ttcctgtggcgcaagcgggacctgtaccagacgctctacgtggacgcggacgaggaggag
atcatccagtacgtggtgggcaccctgcagcccaagctcaagcgtttcctgcgccacccc
ctgcccaagaccctggagcagctcatccagaggggcatggaggtgcaggatgacctggag
caggcggccgagccggccggcccccacctcccggtggaggatgaggcggagaccctcacg
cccgcccccaacagcgagtccgtggccagtgaccggacccagcccgagtag

DBGET integrated database retrieval system