KEGG   Homo sapiens (human): 2328
Entry
2328              CDS       T01001                                 
Symbol
FMO3, FMOII, TMAU, dJ127D3.1
Name
(RefSeq) flavin containing dimethylaniline monoxygenase 3
  KO
K00485  dimethylaniline monooxygenase (N-oxide forming) / hypotaurine monooxygenase [EC:1.14.13.8 1.8.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00430  Taurine and hypotaurine metabolism
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
Disease
H01234  Trimethylaminuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    2328 (FMO3)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    2328 (FMO3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.8  flavin-containing monooxygenase
     2328 (FMO3)
SSDB
Motif
Pfam: FMO-like Pyr_redox_3 Pyr_redox_2 Lys_Orn_oxgnase NAD_binding_8 DAO Pyr_redox MurD-like_N NAD_binding_9 Shikimate_DH AlaDh_PNT_C
Other DBs
NCBI-GeneID: 2328
NCBI-ProteinID: NP_001002294
OMIM: 136132
HGNC: 3771
Ensembl: ENSG00000007933
UniProt: P31513 A0A024R8Z4 Q53FW5
LinkDB
Position
1:171090905..171117819
AA seq 532 aa
MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFS
NSSKEMMCFPDFPFPDDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFA
TTGQWDVTTERDGKKESAVFDAVMVCSGHHVYPNLPKESFPGLNHFKGKCFHSRDYKEPG
VFNGKRVLVVGLGNSGCDIATELSRTAEQVMISSRSGSWVMSRVWDNGYPWDMLLVTRFG
TFLKNNLPTAISDWLYVKQMNARFKHENYGLMPLNGVLRKEPVFNDELPASILCGIVSVK
PNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEIILFKGVFPPL
LEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIKGTCTLPSMEDMMNDINEKMEKKRKWF
GKSETIQTDYIVYMDELSSFIGAKPNIPWLFLTDPKLAMEVYFGPCSPYQFRLVGPGQWP
GARNAILTQWDRSLKPMQTRVVGRLQKPCFFFHWLKLFAIPILLIAVFLVLT
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggggaagaaagtggccatcattggagctggtgtgagtggcttggcctccatcaggagc
tgtctggaagaggggctggagcccacctgctttgagaagagcaatgacattgggggcctg
tggaaattttcagaccatgcagaggagggcagggctagcatttacaaatcagtcttttcc
aactcttccaaagagatgatgtgtttcccagacttcccatttcccgatgacttccccaac
tttatgcacaacagcaagatccaggaatatatcattgcatttgccaaagaaaagaacctc
ctgaagtacatacaatttaagacatttgtatccagtgtaaataaacatcctgattttgca
actactggccagtgggatgttaccactgaaagggatggtaaaaaagaatcggctgtcttt
gatgctgtaatggtttgttccggacatcatgtgtatcccaacctaccaaaagagtccttt
ccaggactaaaccactttaaaggcaaatgcttccacagcagggactataaagaaccaggt
gtattcaatggaaagcgtgtcctggtggttggcctggggaattcgggctgtgatattgcc
acagaactcagccgcacagcagaacaggtcatgatcagttccagaagtggctcctgggtg
atgagccgggtctgggacaatggttatccttgggacatgctgctcgtcactcgatttgga
accttcctcaagaacaatttaccgacagccatctctgactggttgtacgtgaagcagatg
aatgcaagattcaagcatgaaaactatggcttgatgcctttaaatggagtcctgaggaaa
gagcctgtatttaacgatgagctcccagcaagcattctgtgtggcattgtgtccgtaaag
cctaacgtgaaggaattcacagagacctcggccatttttgaggatgggaccatatttgag
ggcattgactgtgtaatctttgcaacagggtatagttttgcctaccccttccttgatgag
tctatcatcaaaagcagaaacaatgagatcattttatttaaaggagtatttcctcctcta
cttgagaagtcaaccatagcagtgattggctttgtccagtcccttggggctgccattccc
acagttgacctccagtcccgctgggcagcacaagtaataaagggaacttgtactttgcct
tctatggaagacatgatgaatgatattaatgagaaaatggagaaaaagcgcaaatggttt
ggcaaaagcgagaccatacagacagattacattgtttatatggatgaactctcctccttc
attggggcaaagcccaacatcccatggctgtttctcacagatcccaaattggccatggaa
gtttattttggcccttgtagtccctaccagtttaggctggtgggcccagggcagtggcca
ggagccagaaatgccatactgacccagtgggaccggtcgttgaaacccatgcagacacga
gtggtcgggagacttcagaagccttgcttctttttccattggctgaagctctttgcaatt
cctattctgttaatcgctgttttccttgtgttgacctaa

DBGET integrated database retrieval system