KEGG   Homo sapiens (human): 23295
Entry
23295             CDS       T01001                                 
Symbol
MGRN1, RNF156
Name
(RefSeq) mahogunin ring finger 1
  KO
K10604  E3 ubiquitin-protein ligase MGRN1 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    23295 (MGRN1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    23295 (MGRN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    23295 (MGRN1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     23295 (MGRN1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    23295 (MGRN1)
SSDB
Motif
Pfam: zf-C3HC4_3 Prok-RING_4 zf-RING_2 zf-RING_5 zf-C3HC4_2
Other DBs
NCBI-GeneID: 23295
NCBI-ProteinID: NP_001135762
OMIM: 607559
HGNC: 20254
Ensembl: ENSG00000102858
Pharos: O60291(Tbio)
UniProt: O60291
LinkDB
Position
16:4624826..4690972
AA seq 552 aa
MGSILSRRIAGVEDIDIQANSAYRYPPKSGNYFASHFFMGGEKFDTPHPEGYLFGENMDL
NFLGSRPVQFPYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDADSPTEDGDKPRVLYSL
EFTFDADARVAITIYCQASEEFLNGRAVYSPKSPSLQSETVHYKRGVSQQFSLPSFKIDF
SEWKDDELNFDLDRGVFPVVIQAVVDEGDVVEVTGHAHVLLAAFEKHMDGSFSVKPLKQK
QIVDRVSYLLQEIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCT
SCADTLRYQANNCPICRLPFRALLQIRAVRKKPGALSPVSFSPVLAQSLEHDEHSCPFKK
SKPHPASLASKKPKRETNSDSVPPGYEPISLLEALNGLRAVSPAIPSAPLYEEITYSGIS
DGLSQASCPLAAIDHILDSSRQKGRPQSKAPDSTLRSPSSPIHEEDEEKLSEDVDAPPPL
GGAELALRESSSPESFITEEVDESSSPQQGTRAASIENVLQDSSPEHCGRGPPADIYLPA
LGPDSCSVGIDE
NT seq 1659 nt   +upstreamnt  +downstreamnt
atgggctccattctcagccgccgcatcgcgggggtggaggacatcgacatccaggcgaac
tcggcctatcgctaccctccgaagtccggaaactactttgcttcgcactttttcatggga
ggagagaaattcgacaccccccaccctgaaggttacctctttggagagaacatggatctg
aacttcctgggcagccgcccggtccagtttccctacgtcactcctgccccccacgagccc
gtgaagacgctgcggagcctggtgaacatccgcaaagactccctgcggctggtgaggtac
aaagacgatgccgacagccccaccgaggacggcgacaagccccgggtgctctacagcctg
gagttcaccttcgacgccgatgcccgcgtggccatcaccatctactgccaggcatcggag
gagttcctgaacggcagggcagtatacagccccaagagcccctcgctacagtccgagacc
gtccactacaagagaggggtgagccagcagttctccctgccctccttcaagattgacttc
tcggaatggaaggatgacgagctgaactttgacctggaccggggcgtgtttccagtagtc
atccaggctgtggtggacgaaggagatgtggtggaagtgactggccacgcccacgtgctc
ttggctgcctttgaaaagcacatggacggcagcttctctgtgaagcctttaaagcagaag
caaattgtggaccgggtcagctacctcctgcaggagatctatggcattgagaacaagaac
aaccaggagaccaagccctcggacgacgagaacagcgacaacagcaacgagtgtgtggtg
tgcctgtccgacctgcgggacacgctgatcctgccctgccgccacctgtgcctctgtacc
tcctgcgccgacacgctgcgctaccaggccaacaactgccccatctgccggctgcctttc
cgggccctcctgcagatccgggcggtgcggaagaagccaggagccctgtcccccgtgtcc
ttcagccccgtcctggcccagagcctggagcatgatgagcactcttgtccctttaaaaaa
tcaaagccgcaccccgcctccctggccagcaagaaacctaaaagggaaacaaactctgac
agcgtcccacctggctacgagcccatctcgctgctcgaggcgctcaacggcctccgggct
gtctccccggccatcccctcggcccctctttatgaagaaatcacctattcaggcatctcg
gacggcctgtcccaggccagctgtcccctcgcggctatcgaccacatcctggacagcagc
cgccagaagggcaggccgcagagcaaggcccccgacagcaccctacggtccccgtcttcc
cccatccacgaagaggatgaggagaagctctccgaggacgtggacgcccctcccccactg
ggtggcgcagagctggccctgcgggaaagcagctcccctgagagtttcataacagaagag
gttgatgagtcgtcgtcaccacagcaagggacccgagcagcttccattgagaatgtcctg
caggacagcagccccgagcactgtggccgaggcccacctgctgacatctacctgccagcc
ctggggcccgactcctgctctgttggtatagacgagtaa

DBGET integrated database retrieval system