KEGG   Homo sapiens (human): 23417
Entry
23417             CDS       T01001                                 

Symbol
MLYCD, MCD
Name
(RefSeq) malonyl-CoA decarboxylase
  KO
K01578  malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00410  beta-Alanine metabolism
hsa00640  Propanoate metabolism
hsa01100  Metabolic pathways
hsa04146  Peroxisome
hsa04152  AMPK signaling pathway
hsa04936  Alcoholic liver disease
Disease
H01283  Malonyl-CoA decarboxylase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    23417 (MLYCD)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    23417 (MLYCD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    23417 (MLYCD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    23417 (MLYCD)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    23417 (MLYCD)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     23417 (MLYCD)
SSDB
Motif
Pfam: MCD MCD_N
Other DBs
NCBI-GeneID: 23417
NCBI-ProteinID: NP_036345
OMIM: 606761
HGNC: 7150
Ensembl: ENSG00000103150
Vega: OTTHUMG00000176654
Pharos: O95822(Tchem)
UniProt: O95822
LinkDB
Structure
PDB: 
2YGW 4F0X

Position
16q23.3
AA seq 493 aa
MRGFGPGLTARRLLPLRLPPRPPGPRLASGQAAGALERAMDELLRRAVPPTPAYELREKT
PAPAEGQCADFVSFYGGLAETAQRAELLGRLARGFGVDHGQVAEQSAGVLHLRQQQREAA
VLLQAEDRLRYALVPRYRGLFHHISKLDGGVRFLVQLRADLLEAQALKLVEGPDVREMNG
VLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISEAEAVHPVKNWMDMKRRVGPYRRCYFF
SHCSTPGEPLVVLHVALTGDISSNIQAIVKEHPPSETEEKNKITAAIFYSISLTQQGLQG
VELGTFLIKRVVKELQREFPHLGVFSSLSPIPGFTKWLLGLLNSQTKEHGRNELFTDSEC
KEISEITGGPINETLKLLLSSSEWVQSEKLVRALQTPLMRLCAWYLYGEKHRGYALNPVA
NFHLQNGAVLWRINWMADVSLRGITGSCGLMANYRYFLEETGPNSTSYLGSKIIKASEQV
LSLVAQFQKNSKL
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgcgaggcttcgggccaggcttgacggccaggcgtctcctcccgctgcggttgcccccg
cggccgcccgggccccggctggcgagcgggcaggcggccggcgccctggagcgggccatg
gacgagctgctgcgccgcgcggtgccgccgacgccggcctacgagctgcgcgagaagaca
ccggcgcccgccgagggtcagtgcgcggacttcgtgagcttctacggtgggctggccgag
acggcccagcgggccgaactgctgggccgcctggcgcggggcttcggcgtggaccacggc
caggtggcggagcagagcgccggcgtgctccatctgcgccagcagcagcgggaggcggcg
gtgctgctgcaggccgaggaccggctgcgctacgcgctggtgccgcgctatcgcggcctc
ttccaccacatcagcaagctggacggcggcgtgcgcttcctggtgcagctgcgggccgac
ctgctggaggcgcaggccctcaagctggtggaggggccggacgtccgggaaatgaatggg
gtgctgaaaggaatgctctcagaatggttttcctccgggttcctgaacctagaacgggtt
acctggcattcaccgtgtgaagtgcttcagaaaatcagtgaggctgaggctgtgcatcct
gtaaaaaactggatggacatgaagcgccgcgttgggccctacagaaggtgttacttcttt
tctcactgttcgacccctggggagcccctggtcgttttgcacgtggcactgactggtgac
atctccagcaacatccaggcaatcgtgaaggaacatcctccatcagaaacagaagagaag
aacaaaatcactgctgcgatcttttattccatcagcttgacccagcagggactccaaggg
gtggagctgggaacattcctcataaagcgagtcgtcaaggagttgcagagagagtttcct
caccttggggtgttttcaagtctgtcacctatacctggtttcaccaaatggcttctgggg
cttctgaactcgcaaacgaaggagcatgggaggaatgaactctttacagattcggaatgt
aaggaaatctcggagatcacaggtggccccattaacgagaccctcaagctcctcctcagc
agcagcgagtgggtgcagtcggagaagctggtgcgggcgctgcagactccgctgatgagg
ctgtgcgcctggtacctgtatggagagaagcaccgcggctacgcgctgaaccccgtggcc
aacttccacctgcagaacggggcggtgctgtggcgcatcaactggatggcggatgtgagc
ctcagaggcatcaccggctcctgcggcctgatggccaactaccgctacttcctggaggag
acgggccccaacagcacctcctacctcggctccaagatcatcaaagcctctgagcaggtc
ctcagcctagtggcccagtttcaaaagaacagcaagctctga

DBGET integrated database retrieval system