KEGG   Homo sapiens (human): 23432
Entry
23432             CDS       T01001                                 

Symbol
GPR161, RE2
Name
(RefSeq) G protein-coupled receptor 161
  KO
K08439  G protein-coupled receptor 161
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    23432 (GPR161)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    23432 (GPR161)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    23432 (GPR161)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 23432
NCBI-ProteinID: NP_001254539
OMIM: 612250
HGNC: 23694
Ensembl: ENSG00000143147
Vega: OTTHUMG00000034651
Pharos: Q8N6U8(Tbio)
UniProt: Q8N6U8
LinkDB
Position
1q24.2
AA seq 529 aa
MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVVTLYKKSYLLT
LSNKFVFSLTLSNFLLSVLVLPFVVTSSIRREWIFGVVWCNFSALLYLLISSASMLTLGV
IAIDRYYAVLYPMVYPMKITGNRAVMALVYIWLHSLIGCLPPLFGWSSVEFDEFKWMCVA
AWHREPGYTAFWQIWCALFPFLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRK
NSSTSTSSSGSRRNAFQGVVYSANQCKALITILVVLGAFMVTWGPYMVVIASEALWGKSS
VSPSLETWATWLSFASAVCHPLIYGLWNKTVRKELLGMCFGDRYYREPFVQRQRTSRLFS
ISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSH
CTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLDSYAASLAKAIEAEAKINLFG
EEALPGVLVTARTVPGGGFGGRRGSRTLVSQRLQLQSIEEGDVLAAEQR
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgagcctcaactcctccctcagctgcaggaaggagctgagtaatctcactgaggaggag
ggtggcgaagggggcgtcatcatcacccagttcatcgccatcattgtcatcaccattttt
gtctgcctgggaaacctggtcatcgtggtcaccttgtacaagaagtcctacctcctcacc
ctcagcaacaagttcgtcttcagcctgactctgtccaacttcctgctgtccgtgttggtg
ctgccttttgtggtgacgagctccatccgcagggaatggatctttggtgtagtgtggtgc
aacttctctgccctcctctacctgctgatcagctctgccagcatgctaaccctcggggtc
attgccatcgaccgctactatgctgtcctgtaccccatggtgtaccccatgaagatcaca
gggaaccgggctgtgatggcacttgtctacatctggcttcactcgctcatcggctgcctg
ccacccctgtttggttggtcatccgtggagtttgacgagttcaaatggatgtgtgtggct
gcttggcaccgggagcctggctacacggccttctggcagatctggtgtgccctcttcccc
tttctggtcatgctggtgtgctatggcttcatcttccgcgtggccagggtcaaggcacgc
aaggtgcactgtggcacagtcgtcatcgtggaggaggatgctcagaggaccgggaggaag
aactccagcacctccacctcctcttcaggcagcaggaggaatgcctttcagggtgtggtc
tactcggccaaccagtgcaaagccctcatcaccatcctggtggtcctcggtgccttcatg
gtcacctggggcccctacatggttgtcatcgcctctgaggccctctgggggaaaagctcc
gtctccccgagcctggagacttgggccacatggctgtcctttgccagcgctgtctgccac
cccctgatctatggactctggaacaagacagttcgcaaagaactactgggcatgtgcttt
ggggaccggtattatcgggaaccatttgtgcaacgacagaggacttccaggctcttcagc
atttccaacaggatcacagacctgggcctgtccccacacctcactgcgctcatggcaggt
ggacagcccctggggcacagcagcagcacgggggacactggcttcagctgctcccaggac
tcagggacagatatgatgctgcttgaggactacacgtctgatgacaaccctccctctcac
tgcacttgcccacccaagagaaggagctcggtgacatttgaggatgaagtggaacaaatc
aaagaagctgccaagaactcgattcttcatgtgaaagctgaagtacacaagtccttggac
agttacgcagcaagcttggccaaagccattgaggccgaagccaaaatcaacttatttggg
gaggaggctttgccaggggtcttggttacagcacggactgtcccggggggcggcttcggg
ggccgccgaggcagcagaactcttgtgagccagaggctgcagttgcagagcatcgaagaa
ggagatgttttagctgccgagcagagatga

DBGET integrated database retrieval system