KEGG   Homo sapiens (human): 23480
Entry
23480             CDS       T01001                                 

Gene name
SEC61G, SSS1
Definition
(RefSeq) SEC61 translocon subunit gamma
  KO
K07342  protein transport protein SEC61 subunit gamma and related proteins
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
hsa04141  Protein processing in endoplasmic reticulum
hsa04145  Phagosome
hsa05110  Vibrio cholerae infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    23480 (SEC61G)
   04141 Protein processing in endoplasmic reticulum
    23480 (SEC61G)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    23480 (SEC61G)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    23480 (SEC61G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hsa02044]
    23480 (SEC61G)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   23480 (SEC61G)
SSDB
Motif
Pfam: SecE Pho88
Other DBs
NCBI-GeneID: 23480
NCBI-ProteinID: NP_001012474
OMIM: 609215
HGNC: 18277
Ensembl: ENSG00000132432
Vega: OTTHUMG00000023430
Pharos: P60059(Tdark)
UniProt: P60059 A0A024QYZ0
LinkDB
Position
7p11.2
AA seq 68 aa
MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIP
INNIIVGG
NT seq 207 nt   +upstreamnt  +downstreamnt
atggatcaggtaatgcagtttgttgagccaagtcggcagtttgtaaaggactccattcgg
ctggttaaaagatgcactaaacctgatagaaaagaattccagaagattgccatggcaaca
gcaataggatttgctataatgggattcattggcttctttgtgaaattgatccatattcct
attaataacatcattgttggtggctga

DBGET integrated database retrieval system