KEGG   Homo sapiens (human): 23746
Entry
23746             CDS       T01001                                 
Symbol
AIPL1, AIPL2, LCA4
Name
(RefSeq) aryl hydrocarbon receptor interacting protein like 1
  KO
K17767  AH receptor-interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04934  Cushing syndrome
hsa05207  Chemical carcinogenesis - receptor activation
Disease
H00837  Leber congenital amaurosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    23746 (AIPL1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    23746 (AIPL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    23746 (AIPL1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    23746 (AIPL1)
SSDB
Motif
Pfam: TPR_2 FKBP_C TPR_8 TPR_11 TPR_12 ANAPC3 CDC37_N F-box-like_2
Other DBs
NCBI-GeneID: 23746
NCBI-ProteinID: NP_055151
OMIM: 604392
HGNC: 359
Ensembl: ENSG00000129221
Pharos: Q9NZN9(Tbio)
UniProt: Q9NZN9 F1T0B6
Structure
LinkDB
Position
17:complement(6423738..6435121)
AA seq 384 aa
MDAALLLNVEGVKKTILHGGTGELPNFITGSRVIFHFRTMKCDEERTVIDDSRQVGQPMH
IIIGNMFKLEVWEILLTSMRVHEVAEFWCDTIHTGVYPILSRSLRQMAQGKDPTEWHVHT
CGLANMFAYHTLGYEDLDELQKEPQPLVFVIELLQVDAPSDYQRETWNLSNHEKMKAVPV
LHGEGNRLFKLGRYEEASSKYQEAIICLRNLQTKEKPWEVQWLKLEKMINTLILNYCQCL
LKKEEYYEVLEHTSDILRHHPGIVKAYYVRARAHAEVWNEAEAKADLQKVLELEPSMQKA
VRRELRLLENRMAEKQEEERLRCRNMLSQGATQPPAEPPTEPPAQSSTEPPAEPPTAPSA
ELSAGPPAEPATEPPPSPGHSLQH
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggatgccgctctgctcctgaacgtggaaggggtcaagaaaaccattctgcacgggggc
acgggcgagctcccaaacttcatcaccggatcccgagtgatctttcatttccgcaccatg
aaatgtgatgaggagcggacagtcattgacgacagtcggcaggtgggccagcccatgcac
atcatcatcggaaacatgttcaagctcgaggtctgggagatcctgcttacctccatgcgg
gtgcacgaggtggccgagttctggtgcgacaccatccacacgggggtctaccccatccta
tcccggagcctgaggcagatggcccagggcaaggaccccacagagtggcacgtgcacacg
tgcgggctggccaacatgttcgcctaccacacgctgggctacgaggacctggacgagctg
cagaaggagcctcagcctctggtctttgtgatcgagctgctgcaggttgatgccccgagt
gattaccagagggagacctggaacctgagcaatcatgagaagatgaaggcggtgcccgtc
ctccacggagagggaaatcggctcttcaagctgggccgctacgaggaggcctcttccaag
taccaggaggccatcatctgcctaaggaacctgcagaccaaggagaagccatgggaggtg
cagtggctgaagctggagaagatgatcaatactctgatcctcaactactgccagtgcctg
ctgaagaaggaggagtactatgaggtgctggagcacaccagtgatattctccggcaccac
ccaggcatcgtgaaggcctactacgtgcgtgcccgggctcacgcagaggtgtggaatgag
gccgaggccaaggcggacctccagaaagtgctggagctggagccgtccatgcagaaggcg
gtgcgcagggagctgaggctgctggagaaccgcatggcggagaagcaggaggaggagcgg
ctgcgctgccggaacatgctgagccagggtgccacgcagcctcccgcagagccacccaca
gagccacccgcacagtcatccacagagccacctgcagagccacccacagcaccatctgca
gagctgtccgcagggccccctgcagagccagccacagagccacccccgtccccagggcac
tcgctgcagcactga

DBGET integrated database retrieval system