KEGG   Homo sapiens (human): 23759
Entry
23759             CDS       T01001                                 
Symbol
PPIL2, CYC4, CYP60, Cyp-60, UBOX7, hCyP-60
Name
(RefSeq) peptidylprolyl isomerase like 2
  KO
K10598  peptidyl-prolyl cis-trans isomerase-like 2 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    23759 (PPIL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    23759 (PPIL2)
   03110 Chaperones and folding catalysts [BR:hsa03110]
    23759 (PPIL2)
   04121 Ubiquitin system [BR:hsa04121]
    23759 (PPIL2)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     23759 (PPIL2)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    23759 (PPIL2)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    23759 (PPIL2)
 Other splicing related proteins
  Minor spliceosome components
   Minor spliceosome associated proteins
    23759 (PPIL2)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    23759 (PPIL2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  U-box type E3
   23759 (PPIL2)
SSDB
Motif
Pfam: Pro_isomerase Rtf2 zf-NOSIP U-box Ribosomal_S6
Other DBs
NCBI-GeneID: 23759
NCBI-ProteinID: NP_001304925
OMIM: 607588
HGNC: 9261
Ensembl: ENSG00000100023
Pharos: Q13356(Tbio)
UniProt: Q13356 A0A024R1C1 A8K0I0
Structure
LinkDB
Position
22:21666012..21700015
AA seq 520 aa
MGKRQHQKDKMYITCAEYTHFYGGKKPDLPQTNFRRLPFDHCSLSLQPFVYPVCTPDGIV
FDLLNIVPWLKKYGTNPSNGEKLDGRSLIKLNFSKNSEGKYHCPVLFTVFTNNTHIVAVR
TTGNVYAYEAVEQLNIKAKNFRDLLTDEPFSRQDIITLQDPTNLDKFNVSNFYHVKNNMK
IIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAPEKKKVDKLNAAH
YSTGKVSASFTSTAMVPETTHEAAAIDEDVLRYQFVKKKGYVRLHTNKGDLNLELHCDLT
PKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSH
TGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTD
RPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAPETKVKSSQPQAGSQGPQTFRQGV
GKYINPAATKRAAEEEPSTSATVPMSKKKPSRGFGDFSSW
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggggaagcgacagcaccaaaaggacaaaatgtacattacctgtgctgaatacactcac
ttttatggtggcaagaagccagatctcccacaaacaaattttcgtcgtttaccttttgac
cactgcagtctctctctgcagccctttgtctacccagtctgcactcccgatggcatcgtc
tttgacttactgaacattgttccatggcttaagaagtacgggaccaaccccagcaatgga
gagaagctggacgggaggtccctgatcaagctgaacttttccaagaacagtgaggggaag
taccactgcccagtgctgtttaccgtgttcaccaacaacacccacatcgtggctgtgagg
acgaccggcaacgtctacgcctatgaggcagtggaacagctaaatatcaaggccaagaac
ttccgggacctgctgaccgacgagcccttctcccggcaggacatcatcaccctccaggac
cccaccaatttggacaagttcaatgtctctaacttctatcatgtgaagaataacatgaaa
ataatagacccagatgaagagaaggccaaacaggacccgtcttattatctgaaaaataca
aatgccgagacccgagagaccctgcaggagctctacaaggagttcaaaggggacgagatt
ctggcagccaccatgaaggccccggagaagaagaaagtggacaagctgaacgctgcccac
tattccacagggaaggtcagcgcttccttcacctccaccgcgatggtcccggagaccaca
catgaagcagctgccatcgacgaggatgtgctgcgctaccagtttgtgaagaagaagggc
tacgtgcggctgcacaccaacaagggcgacctcaacctggagctgcactgcgacctgaca
ccaaaaacctgcgaaaacttcatcaggctttgcaagaagcattattacgatggcaccatc
ttccacagatccatccggaactttgtgatccaagggggcgaccccacaggcacaggcacg
ggtggggagtcatactgggggaagcccttcaaagacgagttccggcccaacctctcgcac
acgggccgcggcatcctcagcatggccaactccgggcccaacagcaacaggtctcaattc
ttcatcacgtttcgctcctgtgcctacctggacaagaagcataccatctttggacgggtt
gttgggggctttgacgtactgacagccatggagaatgtggagagtgaccccaaaactgac
cgccctaaggaggagatccgcattgatgccactacagtgttcgtggacccctatgaggag
gccgatgcccagattgcgcaggagcggaagacacagctcaaggtagccccggagaccaaa
gtgaagagcagccagccccaggcagggagccagggcccccagaccttccgccagggcgtg
ggcaagtacatcaacccagcagccacgaagcgagcagcagaggaagagccctcaaccagt
gccactgtccccatgtccaagaagaagcccagtcggggttttggggacttcagctcctgg
tag

DBGET integrated database retrieval system