KEGG   Homo sapiens (human): 253430
Entry
253430            CDS       T01001                                 

Symbol
IPMK
Name
(RefSeq) inositol polyphosphate multikinase
  KO
K00915  inositol-polyphosphate multikinase [EC:2.7.1.140 2.7.1.151]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    253430 (IPMK)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    253430 (IPMK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.140  inositol-tetrakisphosphate 5-kinase
     253430 (IPMK)
    2.7.1.151  inositol-polyphosphate multikinase
     253430 (IPMK)
SSDB
Motif
Pfam: IPK
Other DBs
NCBI-GeneID: 253430
NCBI-ProteinID: NP_689416
OMIM: 609851
HGNC: 20739
Ensembl: ENSG00000151151
Vega: OTTHUMG00000018268
Pharos: Q8NFU5(Tbio)
UniProt: Q8NFU5
LinkDB
Structure
PDB: 

Position
10q21.1
AA seq 416 aa
MATEPPSPLRVEAPGPPEMRTSPAIESTPEGTPQPAGGRLRFLNGCVPLSHQVAGHMYGK
DKVGILQHPDGTVLKQLQPPPRGPRELEFYNMVYAADCFDGVLLELRKYLPKYYGIWSPP
TAPNDLYLKLEDVTHKFNKPCIMDVKIGQKSYDPFASSEKIQQQVSKYPLMEEIGFLVLG
MRVYHVHSDSYETENQHYGRSLTKETIKDGVSRFFHNGYCLRKDAVAASIQKIEKILQWF
ENQKQLNFYASSLLFVYEGSSQPTTTKLNDRTLAEKFLSKGQLSDTEVLEYNNNFHVLSS
TANGKIESSVGKSLSKMYARHRKIYTKKHHSQTSLKVENLEQDNGWKSMSQEHLNGNVLS
QLEKVFYHLPTGCQEIAEVEVRMIDFAHVFPSNTIDEGYVYGLKHLISVLRSILDN
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggcaacagagccaccatcccccctccgggtcgaggcgccgggccccccagaaatgcgg
acctcaccggcgatcgagtccacccctgagggcaccccgcagccggcgggcggcagactc
cgcttcctcaacggctgcgtgcccctctcgcatcaggtggccgggcacatgtacgggaag
gacaaagtgggtatactgcaacatccagatggcacagttttgaaacagttacaaccacct
ccaaggggcccaagagagctggaattctataatatggtttatgctgctgactgttttgat
ggtgttcttctagagctacgaaaatatttgccaaaatattatggcatctggtcacctccc
actgcaccaaacgatttatacctaaaactggaagatgtgacccataaatttaataagccc
tgtataatggatgtaaagatagggcaaaaaagctatgatccttttgcctcatctgagaag
attcagcaacaggtcagcaagtacccattaatggaagagattgggttcttggtgcttggc
atgagggtttatcatgttcattccgatagctatgagacagaaaaccagcattacggaaga
agcttaacaaaagaaactataaaggatggagtctccagattttttcataatgggtactgc
ttaagaaaagatgctgttgctgccagtattcagaagattgagaaaattctgcagtggttt
gaaaaccagaagcagcttaatttttacgcaagttcattactctttgtttatgaaggttca
tctcagccaaccactacaaaattgaatgacagaactttggcagaaaagtttttgtccaaa
ggacaactgtcagacacagaagtactagagtacaataataactttcatgtgttaagttcc
acagctaatggaaaaatagagtcttcagtgggcaaaagcttgtccaagatgtatgcgcgt
cacaggaaaatatatacaaaaaagcatcacagtcagacttcattgaaagttgaaaatctg
gagcaagacaatgggtggaaaagcatgtcacaggaacatttaaatggaaatgtactttcc
caactggaaaaagttttctaccatcttcccactggttgccaagagattgctgaagtagaa
gtgcgaatgatagattttgctcatgtgttccctagcaacacaatagatgagggatatgtt
tatgggctaaagcatttaatttctgtacttcgaagtattttagacaattga

DBGET integrated database retrieval system