KEGG   Homo sapiens (human): 257313Help
Entry
257313            CDS       T01001                                 

Gene name
UTS2B, U2B, URP, UTS2D
Definition
(RefSeq) urotensin 2B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Urotensin_II
Motif
Other DBs
NCBI-GeneID: 257313
NCBI-ProteinID: NP_937795
HGNC: 30894
Ensembl: ENSG00000188958
Vega: OTTHUMG00000156192
Pharos: Q765I0(Tbio)
UniProt: Q765I0
LinkDB All DBs
Position
3q28
AA seq 119 aa AA seqDB search
MNKILSSTVCFGLLTLLSVLSFLQSVHGRPYLTQGNEIFPDKKYTNREELLLALLNKNFD
FQRPFNTDLALPNKLEELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCV
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatcctctcaagcactgtttgctttggactcctaactttgttatccgtgttg
agttttttacaatctgtgcatggacgaccatatcttacccaaggaaatgaaatatttcca
gataaaaaatatacaaatcgtgaggaactattgctggctctactgaataaaaattttgat
ttccaaagacctttcaacactgacctagccttacctaacaaactggaagaacttaaccag
ctggaaaagctaaaagaacagctagtggaggagaaggattctgagacgtcctatgctgta
gatggtctattctcttctcatcctagcaaacgagcttgcttttggaaatactgtgtttaa

DBGET integrated database retrieval system