KEGG   Homo sapiens (human): 25776
Entry
25776             CDS       T01001                                 
Symbol
CBY1, C22orf2, CBY, Chibby1, HS508I15A, PGEA1, PIGEA-14, PIGEA14, arb1
Name
(RefSeq) chibby family member 1, beta catenin antagonist
  KO
K23402  protein chibby 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    25776 (CBY1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    25776 (CBY1)
Cilium and associated proteins [BR:hsa03037]
 Primary cilia and associated proteins
  Other primary cilia associated proteins
   25776 (CBY1)
SSDB
Motif
Pfam: Chibby TSC22
Other DBs
NCBI-GeneID: 25776
NCBI-ProteinID: NP_001002880
OMIM: 607757
HGNC: 1307
Ensembl: ENSG00000100211
Pharos: Q9Y3M2(Tbio)
UniProt: Q9Y3M2
Structure
LinkDB
Position
22:38656638..38673850
AA seq 126 aa
MPFFGNTFSPKKTPPRKSASLSNLHSLDRSTREVELGLEYGSPTMNLAGQSLKFENGQWI
AETGVSGGVDRREVQRLRRRNQQLEEENNLLRLKVDILLDMLSESTAESHLMEKELDELR
ISRKRK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctttctttgggaatacgttcagtccgaagaagacacctcctcggaagtcggcatct
ctctccaacctgcattctttggatcgatcaacccgggaggtggagctgggcttggaatac
ggatccccgactatgaacctggcagggcaaagcctgaagtttgaaaatggccagtggata
gcagagacaggggttagtggcggtgtggaccggagggaggttcagcgccttcgcaggcgg
aaccagcagttggaggaagagaacaatctcttgcggctgaaagtggacatcttattagac
atgctttcagagtccactgctgaatcccacttaatggagaaggaactggatgaactgagg
atcagccggaagagaaaatga

DBGET integrated database retrieval system