KEGG   Homo sapiens (human): 25981
Entry
25981             CDS       T01001                                 

Gene name
DNAH1, CILD37, DNAHC1, HDHC7, HL-11, HL11, HSRF-1, SPGF18, XLHSRF-1
Definition
(RefSeq) dynein axonemal heavy chain 1
  KO
K10408  dynein heavy chain, axonemal
Organism
hsa  Homo sapiens (human)
Pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
Disease
H00564  Primary ciliary dyskinesia
H01282  Spermatogenic failure
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    25981 (DNAH1)
   05016 Huntington disease
    25981 (DNAH1)
   05022 Pathways of neurodegeneration - multiple diseases
    25981 (DNAH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    25981 (DNAH1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     25981 (DNAH1)
SSDB
Motif
Pfam: AAA_6 DHC_N2 Dynein_C AAA_8 AAA_9 AAA_7 MT AAA_lid_11 Dynein_heavy Dynein_AAA_lid AAA_lid_1 AAA_5 AAA_18 AAA_22 AAA_16 ABC_tran Mg_chelatase AAA_33 AAA_29 Seryl_tRNA_N TBK1_CCD1
Other DBs
NCBI-GeneID: 25981
NCBI-ProteinID: NP_056327
OMIM: 603332
HGNC: 2940
Ensembl: ENSG00000114841
Vega: OTTHUMG00000158378
Pharos: Q9P2D7(Tbio)
UniProt: Q9P2D7 A0A140VJI6
LinkDB
Position
3p21.1
AA seq 4265 aa
MEQPNSKGYSLGRTPQGPECSSAPAVQVGTHRGLEYNPGKILPGSDYGLGNPPALDPKLP
HLPLPPAPPTLSDLGQPRKSPLTGTDKKYPLMKQRGFYSDILSPGTLDQLGEVCRGPRMS
QNLLRQADLDKFTPRVGSFEVPEDFQERMEQQCIGSTTRLLAQTDFPLQAYEPKMQVPFQ
VLPGQHPRKIEIERRKQQYLSLDIEQLLFSQGIDSNKLMPRHLDHQHPQTIEQGHDPIFP
IYLPLKVFDNEDFDCRTPREWINMGLEPGSLDRKPVPGKALLPTDDFLGHEDPKSQKLKY
KWCEVGVLDYDEEKKLYLVHKTDEKGLVRDEMGRPILNAGVTTEGRPPLQVCQYWVPRIQ
LLFCAEDPCMFAQRVVQANALRKNTEALLLYNLYVDCMPSDGQHVISEQSLSKIKQWALS
TPRMRKGPSVLEHLSSLAREVSLDYERSMNKINFDHVVSSKPETFSYVTLPKKEEEQVPE
RGLVSVPKYHFWEQKEDFTFVSLLTRPEVITALSKVRAECNKVTAMSLFHSSLSKYSHLE
EFEQIQSQTFSQVQMFLKDSWISSLKVAMRSSLRDMSKGWYNLYETNWEVYLMSKLRKLM
ELVKYMLQDTLRFLVQDSLASFSQFISDTCCSVLNCTDDMVWGDDLINSPYRPRKNPLFI
MDLVLDSSGVHYSTPLEQFEASLLNLFDKGILATHAVPQLEKLVMEDIFISGDPLLESVG
LHEPLVEELRATIASAVSKAMIPLQAYAKEYRKYLELNNNDIASFLKTYQTQGLLAQEVR
EVVLTHLREKEILDSSLPSSIIIGPFYINTDNVKQSLSKKRKALATSVLDILAKNLHKEV
DSICEEFRSISRKIYEKPNSIEELAELREWMKGIPERLVGLEERIVKVMDDYQVMDEFLY
NLSSDDFNDKWIASNWPSKILGQIELVQQQHVEDEEKFRKIQIMDQNNFQEKLEGLQLVV
AGFSIHVEISRAHEIANEVRRVKKQLKDCQQLAMLYNNRERIFSLPITNYDKLSRMVKEF
QPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEKNVVEAFKTMHKCVKQFKDMPACQEV
ALDIRARIEEFKPYIPLIQGLRNPGMRIRHWETLSNQININVRPKANLTFARCLEMNLQD
HIESISKVAEVAGKEYAIEQALDKMEKEWSTILFNVLPYKATDTYILKSPDEASQLLDDH
IVMTQNMSFSPYKKPFEQRINSWENKLKLTQEVLEEWLNCQRSWLYLEPIFSSEDINQQL
PVESKRYQTMERIWKKIMKNAYENREVINVCSDLRMLDSLRDCNKILDLVQKGLSEYLET
KRSAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARLLFQEDLEITHMYSAEGE
EVQLCFSIYPSSNVEDWLREVERSMKASVHDIIEKAIRAYPTMPRTQWVLNWPGQVTIAG
CQTYWTMEVAEALEAGNLRSQLFPQLCQQLSDLVALVRGKLSRMQRAVLSALIVIEVHAK
DVVSKLIQENVVSVNDFQWISQLRYYWTNNDLYIRAVNAEFIYGYEYLGNSGRLVITPLT
DRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFF
KGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVERFMFEGVEIPLVPSCAVF
ITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMITEISLYSFGFNEASVLAKKITTTFKL
SSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPSMNEELICLRAIRDVNVPKFLQEDLKL
FSGIVSDLFPTIKEEDTDYGILDEAIREACRNSNLKDVEGFLTKCIQLYETTVVRHGLML
VGPTGSGKSTCYRVLAAAMTSLKGQPSISGGMYEAVNYYVLNPKSITMGQLYGEFDLLTH
EWTDGIFSSFIRAGAITSDTNKKWYMFDGPVDAIWIENMNTVLDDNKKLCLSSGEIIKLT
EAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFIECWLRKLPPLLKPYEEHFKAL
FVSFLEESISFVRSSVKEVIASTNCNLTMSLLKLLDCFFKPFLPREGLKKIPSEKLSRIV
ELIEPWFIFSLIWSVGATGDSSGRTSFSHWLRLKMENEQLTLLFPEEGLVFDYRLEDAGI
SGTNDSEDEEEEYKQVAWVKWMDSSAPFTMVPDTNYCNIIVPTMDTVQMSHLLDMLLTNK
KPVLCIGPTGTGKTLTISDKLLKNLALDYISHFLTFSARTSANQTQDFIDSKLDKRRKGV
FGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKIIGAFKNLVDINFV
CAMGPPGGGRNTVTPRLMRHFNYLSFAEMDEVSKKRIFSTILGNWLDGLLGEKSYRERVP
GAPHIAHFTEPLVEATIMVYATITSQLLPTPAKSHYTFNLRDLSKVFQGMLMADPAKVED
QVQLLRLWYHENCRVFRDRLVNEEDRSWFDQLLKRCMEQWEVTFNKVCPFQPILYGDFMS
PGSDVKSYELITSESKMMQVIEEYIEDYNQINTAKLKLVLFMDAMSHICRISRTLRQALG
NALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWRDDVKKVLLKAGLQNLPIT
FLFSDTQIKNESFLEDINNVLNSGDIPNLYTADEQDQIVSTMRPYIQEQGLQPTKANLMA
AYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATVFLNE
IPELESSQEEIQGLIQVCVYIHQSVSKKCIEYLAELTRHNYVTPKSYLELLHIFSILIGQ
KKLELKTAKNRMKSGLDKLLRTSEDVAKMQEDLESMHPLLEEAAKDTMLTMEQIKVDTAI
AEETRNSVQTEEIKANEKAKKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRA
MQRPPPGVKLVIEAVCIMKGIKPKKVPGEKPGTKVDDYWEPGKGLLQDPGHFLESLFKFD
KDNIGDVVIKAIQPYIDNEEFQPATIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQAL
LEAQDDLGVTQRILDEAKQRLREVEDGIATMQAKYRECITKKEELELKCEQCEQRLGRAG
KLINGLSDEKVRWQETVENLQYMLNNISGDVLVAAGFVAYLGPFTGQYRTVLYDSWVKQL
RSHNVPHTSEPTLIGTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQSQA
NKWIKNMEKDNGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYK
QQGNTVLKLGDTVIPYHEDFRMYITTKLPNPHYTPEISTKLTLINFTLSPSGLEDQLLGQ
VVAEERPDLEEAKNQLIISNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKM
KAAEIQAKVRIAEQTEKDIDLTRMEYIPVAIRTQILFFCVSDLANVDPMYQYSLEWFLNI
FLSGIANSERADNLKKRISNINRYLTYSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKI
NQSEWRYLLSGGSISIMTENPAPDWLSDRAWRDILALSNLPTFSSFSSDFVKHLSEFRVI
FDSLEPHREPLPGIWDQYLDQFQKLLVLRCLRGDKVTNAMQDFVATNLEPRFIEPQTANL
SVVFKDSNSTTPLIFVLSPGTDPAADLYKFAEEMKFSKKLSAISLGQGQGPRAEAMMRSS
IERGKWVFFQNCHLAPSWMPALERLIEHINPDKVHRDFRLWLTSLPSNKFPVSILQNGSK
MTIEPPRGVRANLLKSYSSLGEDFLNSCHKVMEFKSLLLSLCLFHGNALERRKFGPLGFN
IPYEFTDGDLRICISQLKMFLDEYDDIPYKVLKYTAGEINYGGRVTDDWDRRCIMNILED
FYNPDVLSPEHSYSASGIYHQIPPTYDLHGYLSYIKSLPLNDMPEIFGLHDNANITFAQN
ETFALLGTIIQLQPKSSSAGSQGREEIVEDVTQNILLKVPEPINLQWVMAKYPVLYEESM
NTVLVQEVIRYNRLLQVITQTLQDLLKALKGLVVMSSQLELMAASLYNNTVPELWSAKAY
PSLKPLSSWVMDLLQRLDFLQAWIQDGIPAVFWISGFFFPQAFLTGTLQNFARKFVISID
TISFDFKVMFEAPSELTQRPQVGCYIHGLFLEGARWDPEAFQLAESQPKELYTEMAVIWL
LPTPNRKAQDQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPTHQPQRHWIKRGVALI
CALDY
NT seq 12798 nt   +upstreamnt  +downstreamnt
atggagcagcctaacagtaaaggctatagcctgggaaggacccctcagggcccagagtgc
agcagtgctcctgcagtccaagtggggacccacaggggcctagagtataacccggggaag
attcttccaggatcagactatgggttgggaaatcctccagcccttgaccccaagctccca
catttacccctgcccccggccccacccacactctcagacttggggcagccacggaagtca
cccctgacaggcactgataagaagtacccgctgatgaagcagcgtgggttctactccgac
atcctcagccctggaaccttagatcaacttggggaggtatgtcgtggcccccgaatgagc
cagaacctcctgcggcaggctgaccttgacaagttcaccccaagagtcggaagctttgag
gttcctgaagacttccaggagcgcatggagcagcagtgcatcgggtccaccacccggctg
ctcgcccagactgacttcccactgcaggcctacgagcccaagatgcaggtgcctttccag
gtgctgccaggccagcatcctcgcaagattgagatcgagaggaggaaacagcagtacctg
agcctggacattgagcagttgctgttcagccagggcatcgactccaacaagctcatgccc
aggcacctggaccaccagcacccccaaaccatcgaacagggccatgacccaatcttcccc
atctacctcccactgaaggtatttgacaatgaggactttgactgccggactcccagagag
tggatcaacatgggcttggagccagggtctctggacaggaaacctgtcccgggaaaagcc
ctcttgcccactgatgacttcctggggcatgaggaccccaagagtcagaagctgaagtac
aaatggtgcgaggtcggcgtcctggactacgacgaggagaagaagctatacctggtacac
aagacagacgagaaaggcctggtgcgagatgagatggggaggcccatcctgaatgcaggg
gtcaccactgaaggaaggccaccccttcaggtctgtcagtactgggtgccacggatccag
cttctcttctgcgctgaggacccttgcatgttcgcacaacgtgtggtccaggccaacgcc
ctgcgcaagaacacggaagcactgctgctctacaacttgtatgtggactgcatgccctct
gacggccagcatgtcatcagtgaacagagcctgagcaagatcaagcagtgggccctgagc
acgcctcggatgcgcaaaggcccctcggttctagagcacctcagcagtcttgccagagaa
gtgagcctggactatgagcgcagcatgaacaagatcaactttgaccacgttgtctcttcc
aagcccgagaccttctcctacgtcaccctccccaagaaggaggaggagcaggtgcctgag
cgagggctggtgagtgtccccaagtaccacttctgggagcagaaggaggacttcactttc
gtgtccctgctcacacggccagaggtcatcacggccctcagcaaggtgagggccgagtgc
aacaaggtgaccgccatgtccctgttccactcgagcctctccaagtacagccacctggag
gaatttgagcagatccagtcacagaccttctcccaggtgcagatgttcctcaaggacagc
tggatcagctcgctaaaggtggccatgcgcagcagcctgcgcgacatgagcaagggctgg
tacaacctctacgagaccaactgggaggtgtacctcatgtccaagctgcgcaagctgatg
gagctggtgaagtacatgctgcaggacacactgcgcttcctggtgcaggactcacttgcc
agcttctcacagttcatcagcgacacctgttgcagcgtgctcaactgcaccgatgacatg
gtctggggtgacgacttaattaacagcccctacaggccccggaagaatcccctgttcatc
atggacctggtgctggacagctctggggtgcactatagcaccccactggagcagtttgag
gcatctctgctgaacctcttcgacaagggcatcctggccacccatgccgtgccccagctg
gagaagctggtgatggaggacatcttcatcagcggtgaccccctgctggagtccgtgggc
cttcatgagccactggtggaagagctacgggccaccattgccagtgccgtgtccaaggcc
atgatcccactgcaggcctacgccaaggagtaccgaaagtacctggagctgaacaacaat
gacattgcctcctttctcaaaacctaccagacgcagggcctgttggcccaggaggtgcgg
gaggtagtgctcacccacctgcgggagaaggagatcctggacagctcgctgcccagcagc
atcatcattgggcctttctacatcaacaccgacaatgtcaagcagagcctgtccaagaaa
cgcaaggccctggccacttccgtgctggacatccttgccaagaacctgcataaggaggtg
gatagcatctgcgaggagttccgcagcatcagccgcaagatctatgagaagcccaacagc
attgaggagctggctgagctgcgagagtggatgaagggcatcccggagaggctggtgggc
ctggaggagcggattgtgaaggtcatggatgactaccaggtcatggatgaattcctctac
aacctcagctcagatgacttcaatgacaaatggattgccagcaactggccttctaagatc
cttgggcagatagagctggtgcagcagcagcatgtggaggatgaggagaagttccgcaaa
atccagatcatggatcagaacaacttccaagagaagctggaagggctgcagctggtagta
gctggcttctccatccatgtggagatttcacgtgcacacgagatcgccaacgaggtgcgg
cgtgtcaagaagcagctgaaggactgccagcagctggccatgctctacaacaaccgcgag
cgcatcttcagcttgcccatcaccaattatgacaagctctccaggatggtgaaggagttc
caaccctacctggacctttggaccacagcgtctgactggctgcgctggtcggagagctgg
atgaatgaccccctctctgccatcgatgctgagcagctggagaagaacgtggttgaagcc
ttcaagaccatgcacaagtgcgtgaagcagtttaaggacatgccagcctgccaggaagtg
gccttggacatccgggcccgcatcgaggagttcaaaccatacatcccactgatccagggg
ctgcgcaaccctggcatgcggatccggcactgggagacactgtccaaccagatcaacatc
aatgtcaggcccaaggccaacctgacctttgctcgctgcctggagatgaacctgcaggac
catatcgagagcatcagcaaggtggctgaggtggctggcaaggagtacgccatcgagcag
gcactggacaagatggagaaggagtggtcgaccatcctgttcaatgtactgccctacaag
gcgacagacacctacatcctgaagagcccggacgaggcctcacagctgctggacgaccac
atcgtcatgacccagaatatgtcattttcaccctacaagaagccctttgagcagcgcatc
aactcctgggagaacaaactgaagctgacccaggaggttctggaggagtggctgaactgt
cagcggtcctggctctacctggagcccatctttagctctgaggacatcaaccagcagctg
cctgtggagagcaagcgctaccagaccatggagcggatctggaagaagatcatgaagaat
gcctacgagaaccgggaggtgatcaatgtgtgttccgacctgagaatgctggacagcctg
cgggactgcaacaagattctggacctggtgcagaagggcctcagcgagtatctggagacc
aagaggagcgccttccccagattctacttcctgtcagatgatgaactactagagatcttg
tcgcagacaaaggaccccacggccgtgcagccacacctgcgcaagtgcttcgagaacatc
gctcggctgctattccaggaggacctggagatcacgcacatgtactcagccgagggggag
gaggtacagttgtgcttctccatctacccctccagcaacgtggaggactggctgcgggag
gtggagcgcagcatgaaggccagtgtgcacgacatcattgagaaggccatcagggcctac
cccacgatgcccaggacccagtgggttctgaactggcctggccaggtgaccatcgctggg
tgccagacctactggaccatggaggtggcagaggctctggaggccggcaacctcagaagc
caactgttcccccagctctgccagcagctcagtgatctggtggcccttgtgcgggggaag
ctgtcccgcatgcagcgggcagtgctgtcagcgctaatcgtcattgaggtccatgccaag
gacgtggtgagcaagctaatccaggagaacgtggtcagcgtgaatgacttccagtggatc
tcacagctgaggtactactggacaaataatgacctgtatatccgtgctgtgaatgctgag
ttcatctatggctatgagtacctgggcaacagtgggaggctggtgatcacgcccctcacc
gacaggtgctacctgacactgaccggagctctgcacctcaagtttgggggtgccccagct
ggcccagctggcacaggcaaaactgagaccaccaaagacctgggtaaggccttggccata
cagaccgttgtgttcaactgctctgaccagctcgacttcatggccatgggcaagttcttc
aagggcctggccagtgctggggcctgggcctgcttcgacgagttcaatcgcatcgacatc
gaggtgctgtctgtggtggcgcagcagatcaccaccatccagaaggcgcagcagcagcgg
gtggaacgcttcatgtttgagggtgtggagatcccactggtgccatcctgcgcagtgttt
atcaccatgaacccgggctacgctggccgcacggagctgcctgacaatctgaaggcgctc
ttccgacccgtggccatgatggttccagattacgccatgatcactgagatctccctctat
tcctttggctttaatgaggccagtgtgctggctaagaagatcacaaccaccttcaagctg
tcttctgagcagctcagctcccaggatcactatgacttcgggatgagagccgtgaaaact
gtgatctcggctgctgggaacctcaagcgagaaaaccccagcatgaatgaggagctgatc
tgcctccgggccatccgtgatgtgaacgtgcccaagttcctgcaggaggacctcaagctc
ttctctggcatcgtgtccgacctgtttcccaccatcaaggaggaggacacggactacggc
atcctggatgaggccatccgcgaggcctgcaggaacagcaacctcaaggatgtggagggc
ttcctgacaaagtgcatccagctctacgagaccacggtggtacgacacggcctcatgctc
gtcgggcccacaggctccggcaagagtacttgttacagagtcctggcagctgccatgacg
tcactgaaagggcagccatccatcagtggtggcatgtacgaggctgtcaactactacgtg
ctcaaccccaagtccatcacgatgggccagctgtacggggagtttgacctcctcacccat
gagtggacagacgggatattctcctcgttcatccgggcgggggccatcacctccgacacc
aacaagaagtggtacatgttcgatgggccggtggatgccatctggattgagaacatgaac
acggtgctggatgacaacaagaagctgtgcctcagctctggggagatcatcaagctcaca
gaggcaatgaccatgatgttcgaggtgcaagacctggcggtggcttcaccagctacagtc
tcccgctgtggcatggtgtacctggagcccagcatcctggggctcatgcccttcatcgag
tgctggctgaggaagctgcctcccttgctgaagccctatgaggagcatttcaaggccctc
tttgtcagcttcctggaggaatccatctccttcgttcggtcctcagtgaaggaggtgatc
gcctcaaccaactgcaacctgaccatgagcctcctcaagctgctggactgcttcttcaag
ccctttctgcctagagagggcctcaagaaaataccctctgaaaagctgagtcgcatcgta
gagttgatcgagccctggttcatcttctccctgatctggagcgtgggtgccactggggac
agcagtggccgcaccagtttcagccactggctaaggctcaagatggagaacgaacagctg
actctgcttttcccagaagaggggctggtgttcgattacaggctggaggacgcgggcatc
agtggcaccaacgacagtgaggatgaagaggaggaatacaagcaggttgcctgggtgaag
tggatggactcctcagctccattcaccatggtaccagacaccaactactgcaacatcatt
gtgcccaccatggacaccgtgcagatgtcccatttactggacatgctgctcaccaacaag
aagcccgtgctgtgcattgggccaacaggcacggggaagacgctcaccatctctgacaag
ctcctcaagaacctggcactggattacatcagccacttcctcaccttctcagcccgcact
tcagccaaccagacccaggacttcattgacagcaagctggacaagaggcggaagggtgtg
tttggaccacctctggggcgcaactttatcttcttcatcgatgacctgaacatgccggcc
ctggagacctacggtgcacagccacccatcgagctgttgcgccagtggatggaccacggc
ggctggtacgaccgcaagatcattggtgccttcaagaacctagtggacatcaactttgtc
tgtgccatgggccccccgggtggaggcaggaacaccgtcaccccgcggctgatgcgtcac
ttcaactacctgtctttcgctgagatggacgaggtcagcaagaaacgcatcttctccacc
atcctgggcaactggttggatggactccttggagaaaaaagctaccgggagcgtgtgcct
ggggccccccacattgcccacttcacggagccccttgtggaagccaccatcatggtgtat
gcaaccatcacctcccagctgctgcccactccagccaagtcccactacaccttcaacctg
agggacctctccaaggtcttccaaggcatgctcatggctgacccggccaaggtcgaggac
caagtgcagctgctgcgactgtggtatcacgagaactgccgcgtgttccgggaccgactg
gtgaatgaggaggaccgcagctggttcgaccagctcctcaagcgctgcatggagcagtgg
gaggtgaccttcaacaaggtctgccccttccagcccattctttacggggacttcatgtca
ccaggctccgatgtcaagtcctacgagctcatcaccagtgagagtaagatgatgcaggtg
atagaggagtacatagaggactacaaccagatcaacacggccaagctgaagctggtcctc
ttcatggacgccatgagccacatctgtcgcatcagccgcaccctacgccaggcgctgggc
aatgcactcctgctgggcgtgggtggcagcggccgcagctccctcacaaggctcgcctcg
cacatggccgagtacgagtgcttccagattgaactatccaagaactacggcatgtccgag
tggcgagatgatgtgaagaaggtcctgctcaaggcgggcctacagaacctacccatcacc
ttcctcttctcagacacccagatcaagaacgaatccttcctggaagatatcaacaacgtc
ctaaactctggtgacattcccaatctgtatactgcggacgagcaggaccagatcgtcagc
accatgcggccctatatccaggagcagggcctacagcccaccaaggccaacctcatggct
gcttacacagggcgtgtgcgcagcaacatccacatggtgctgtgcatgagccccatcgga
gaggtcttccgagctcgtctgaggcagtttccctccctggtcaactgctgtaccatcgac
tggtttaacgagtggccggcagaagccctgaagtctgtggccaccgtgttcctcaatgag
atcccagaactggaatcctcccaggaagaaatccaaggactgatccaggtctgtgtgtac
atccaccagtcggtgtccaagaagtgcatcgagtacctggcagagctgacccgccacaac
tatgtgacccccaagagctacttggagctgcttcatattttctccatcctcatcgggcag
aagaaactggagctgaaaactgccaagaaccgcatgaagagcggcctcgacaagctgctg
cgcacttctgaggatgtagccaagatgcaggaggacctggagagtatgcaccccctgctg
gaggaggctgccaaggacaccatgctcaccatggagcagatcaaggtggatacggccatc
gccgaggagacccggaattcagtgcagacagaggagatcaaagccaatgagaaggccaag
aaggcacaagctattgctgacgatgcccagaaggacctggacgaggcgttgccagccctg
gatgcggctctggccagcctgcgcaacctcaacaagaacgatgtgaccgaggtacgtgcc
atgcagcggccacccccgggtgtgaaactggtcatagaagctgtgtgcattatgaaaggc
atcaagcccaagaaggtgcctggagaaaagccaggcaccaaggtggatgactactgggag
cctggcaaggggctgctgcaggacccgggccacttccttgagagcctcttcaagtttgac
aaggacaacattggggatgtggtgatcaaagccatccagccgtacatcgataatgaagag
ttccagccagccaccattgccaaggtgtccaaggcttgcacctccatctgccagtgggtg
cgcgccatgcacaagtaccactttgtggccaaggccgtggagcccaagcggcaagccctg
ctggaggcccaggatgacctgggggtgacacagaggatcctggatgaggcaaaacagcgc
cttcgtgaggtggaggacggcatcgccacaatgcaggctaagtaccgggaatgcattacc
aagaaggaggagctggagctgaagtgtgagcagtgtgagcagcggctgggccgagctggc
aagctcatcaacgggctgtcggatgagaaggtgcgctggcaggagacggtggagaacctg
cagtacatgctcaacaacatctccggcgatgtcctggtggccgctggctttgtggcctac
ctgggccccttcacgggccagtaccgcacggtgctctacgacagctgggtcaagcagctc
aggagccacaatgtcccacacacctccgagcccacgctaatcgggacgctggggaaccct
gtgaagatccgatcgtggcagatcgctggcctccccaacgacacactgtcagtggagaac
ggggtcatcaaccagttttcccagcgctggacccacttcattgaccctcagagccaggcc
aacaaatggatcaagaacatggagaaggacaatgggctggatgtgttcaagttgagtgac
cgcgacttcctgcgcagcatggagaacgccatccgctttggcaagccatgtctcctggag
aacgtgggcgaggagctagacccagccctggagccagtgctgctcaagcagacgtacaag
cagcagggaaacacggtgctgaagctgggggacacggtgatcccctaccatgaggacttc
aggatgtacatcaccaccaagctgcccaacccacactacacgcccgagatctccaccaaa
ctcaccctcatcaacttcaccctgtcgcccagtggcctagaggaccagctactgggccag
gtagtggcagaggagcgacccgacctggaggaggccaagaaccagctgattatcagtaat
gccaagatgcgccaggagctgaaggacattgaggaccagatcctgtaccggctcagctcc
tccgagggcaaccctgtagatgacatggaactcatcaaggtgctggaagcctccaagatg
aaggctgctgagatccaggccaaagtcaggattgcagagcagacggagaaggacatcgac
ctgacgcgcatggagtacatacccgtggccatccgcacccagatcctcttcttctgtgtg
tccgacctggccaacgtggaccccatgtaccagtactcccttgagtggtttctcaacatc
ttcctctcgggcatcgccaactcagagagagcagacaacctgaagaagcgcatctccaac
atcaaccgctacctgacctacagcctctacagcaacgtctgccgcagcctctttgagaag
cacaagctgatgtttgccttcctgctgtgtgttcgcatcatgatgaacgagggcaaaatc
aaccagagtgagtggcgatacctcctgtctgggggctccatctcgatcatgactgagaat
ccggcaccggactggctgtcagaccgggcttggcgagacatcctagcactctcgaacctg
ccaaccttttcctccttctcttccgacttcgtgaagcacctctcagaattccgggtcatc
ttcgacagccttgagccccaccgggagcctttgcctggcatctgggaccagtacctagac
cagttccagaagctgctagtcctccgctgcctgcgtggggacaaggttaccaacgccatg
caggactttgtggccaccaacctggagccacgcttcattgaaccccagacagccaatctg
tcagtggtgttcaaagactccaactccaccacacccctcatctttgtgctgtcacccggc
acagaccctgctgccgacctctacaagtttgccgaagaaatgaagttctccaaaaagctc
tctgccatctccctgggccaggggcagggccctcgggcagaagccatgatgcgcagctcc
atagagaggggcaaatgggtcttcttccagaactgccacctggcaccaagctggatgcca
gccctagaacgcctcatcgagcacatcaaccccgacaaggtacacagggacttccgcctc
tggctcaccagcctgcccagcaacaagttcccagtgtccatcctgcagaacggctccaag
atgaccattgagccgccacgcggtgtcagggccaacctgctgaagtcctatagtagcctt
ggtgaagacttcctcaactcctgccacaaggtgatggagttcaagtctctgctgctgtct
ctgtgcttgttccatgggaacgccctggagcgccgtaagtttgggcccctgggcttcaac
atcccctatgagttcacggatggagatctgcgcatctgcatcagccagctcaagatgttc
ctggacgaatatgatgacatcccctacaaggtcctcaagtacacggcaggggagatcaat
tacgggggccgtgtcactgatgactgggaccggcgctgcatcatgaacatcttggaggac
ttctacaaccctgacgtgctctcccctgagcacagctacagcgcctcgggcatctaccac
cagatcccgcctacctacgacctccacggctacctctcctacatcaagagcctcccactc
aatgatatgcctgagatctttggcctgcatgacaatgccaacatcacctttgcccagaac
gagacgttcgccctcctgggcaccatcatccagctgcaacccaaatcatcttctgcaggc
agccagggccgggaggagatagtggaggacgtcacccaaaacattctgctcaaggtgcct
gagcctatcaacttgcaatgggtgatggccaagtacccagtgctgtatgaggaatcaatg
aacacagtactagtacaagaggtcattaggtacaatcggctgctgcaggtgatcacacag
acactgcaagacctactcaaggcactcaaggggctggtagtgatgtcctctcagctggag
ctgatggctgccagcctgtacaacaatactgtgcctgagctctggagtgccaaggcctac
ccatcgctcaagcctctgtcatcatgggtcatggacctgctgcaacgcctggactttctg
caggcctggatccaagatggcatcccagctgtcttctggatcagtggattcttcttcccc
caggctttcttaacaggcactctgcagaattttgcccgcaaatttgtcatctccattgac
accatctcctttgatttcaaggtgatgtttgaggcaccatcagagttaacacaaagaccc
caagtagggtgctatatccatggattattcctggaaggtgcccgctgggatccagaggcc
ttccagctggctgagtctcagcccaaggagctgtacacagagatggccgttatctggctc
ttgccaacacccaaccgcaaggcccaggaccaggacttttacctgtgccccatctacaag
acactgactcgtgctggaacactatcaaccacaggacactctaccaactatgtcattgct
gtggagatccccacccatcagccccagcgacactggataaagcgtggtgtggccctcatc
tgtgccctggactactag

DBGET integrated database retrieval system