KEGG   Homo sapiens (human): 26037
Entry
26037             CDS       T01001                                 
Symbol
SIPA1L1, E6TP1, SPAR1
Name
(RefSeq) signal induced proliferation associated 1 like 1
  KO
K17701  signal-induced proliferation-associated 1 like protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    26037 (SIPA1L1)
SSDB
Motif
Pfam: SPAR_C Rap_GAP PDZ DUF4164 PDZ_6 Rootletin DUF2046 ATG16 Sec34 YabA RasGAP_C
Other DBs
NCBI-GeneID: 26037
NCBI-ProteinID: NP_056371
OMIM: 617504
HGNC: 20284
Ensembl: ENSG00000197555
Pharos: O43166(Tdark)
UniProt: O43166
LinkDB
Position
14:71320476..71741209
AA seq 1804 aa
MTSLKRSQTERPLATDRASVVGTDGTPKVHTDDFYMRRFRSQNGSLGSSVMAPVGPPRSE
GSHHITSTPGVPKMGVRARIADWPPRKENIKESSRSSQEIETSSCLDSLSSKSSPVSQGS
SVSLNSNDSAMLKSIQNTLKNKTRPSENMDSRFLMPEAYPSSPRKALRRIRQRSNSDITI
SELDVDSFDECISPTYKTGPSLHREYGSTSSIDKQGTSGESFFDLLKGYKDDKSDRGPTP
TKLSDFLITGGGKGSGFSLDVIDGPISQRENLRLFKEREKPLKRRSKSETGDSSIFRKLR
NAKGEELGKSSDLEDNRSEDSVRPWTCPKCFAHYDVQSILFDLNEAIMNRHNVIKRRNTT
TGASAAAVASLVSGPLSHSASFSSPMGSTEDLNSKGSLSMDQGDDKSNELVMSCPYFRNE
IGGEGERKISLSKSNSGSFSGCESASFESTLSSHCTNAGVAVLEVPKENLVLHLDRVKRY
IVEHVDLGAYYYRKFFYQKEHWNYFGADENLGPVAVSIRREKPDEMKENGSPYNYRIIFR
TSELMTLRGSVLEDAIPSTAKHSTARGLPLKEVLEHVVPELNVQCLRLAFNTPKVTEQLM
KLDEQGLNYQQKVGIMYCKAGQSTEEEMYNNESAGPAFEEFLQLLGERVRLKGFEKYRAQ
LDTKTDSTGTHSLYTTYKDYEIMFHVSTMLPYTPNNKQQLLRKRHIGNDIVTIVFQEPGA
QPFSPKNIRSHFQHVFVIVRVHNPCSDSVCYSVAVTRSRDVPSFGPPIPKGVTFPKSNVF
RDFLLAKVINAENAAHKSEKFRAMATRTRQEYLKDLAEKNVTNTPIDPSGKFPFISLASK
KKEKSKPYPGAELSSMGAIVWAVRAEDYNKAMELDCLLGISNEFIVLIEQETKSVVFNCS
CRDVIGWTSTDTSLKIFYERGECVSVGSFINIEEIKEIVKRLQFVSKGCESVEMTLRRNG
LGQLGFHVNYEGIVADVEPYGYAWQAGLRQGSRLVEICKVAVATLSHEQMIDLLRTSVTV
KVVIIPPHDDCTPRRSCSETYRMPVMEYKMNEGVSYEFKFPFRNNNKWQRNASKGPHSPQ
VPSQVQSPMTSRLNAGKGDGKMPPPERAANIPRSISSDGRPLERRLSPGSDIYVTVSSMA
LARSQCRNSPSNLSSSSDTGSVGGTYRQKSMPEGFGVSRRSPASIDRQNTQSDIGGSGKS
TPSWQRSEDSIADQMAYSYRGPQDFNSFVLEQHEYTEPTCHLPAVSKVLPAFRESPSGRL
MRQDPVVHLSPNKQGHSDSHYSSHSSSNTLSSNASSAHSDEKWYDGDRTESELNSYNYLQ
GTSADSGIDTTSYGPSHGSTASLGAATSSPRSGPGKEKVAPLWHSSSEVISMADRTLETE
SHGLDRKTESSLSLDIHSKSQAGSTPLTRENSTFSINDAASHTSTMSSRHSASPVVFTSA
RSSPKEELHPAAPSQLAPSFSSSSSSSSGPRSFYPRQGATSKYLIGWKKPEGTINSVGFM
DTRKRHQSDGNEIAHTRLRASTRDLRASPKPTSKSTIEEDLKKLIDLESPTPESQKSFKF
HALSSPQSPFPSTPTSRRALHRTLSDESIYNSQREHFFTSRASLLDQALPNDVLFSSTYP
SLPKSLPLRRPSYTLGMKSLHGEFSASDSSLTDIQETRRQPMPDPGLMPLPDTAADLDWS
NLVDAAKAYEVQRASFFAASDENHRPLSAASNSDQLEDQALAQMKPYSSSKDSSPTLASK
VDQLEGMLKMLREDLKKEKEDKAHLQAEVQHLREDNLRLQEESQNASDKLKKFTEWVFNT
IDMS
NT seq 5415 nt   +upstreamnt  +downstreamnt
atgaccagcttgaaacggtcacagacagaaaggcctcttgccactgacagggcctctgtt
gttggcacagacggcacccccaaagtccacactgatgatttctacatgcggcgcttccgg
tcccaaaatggcagcttaggatcatcagttatggctcctgtaggacccccccgaagtgaa
ggttctcaccatataacctcaacccccggagtcccaaaaatgggggtaagggcaaggatt
gcagattggcccccaagaaaggaaaacataaaagaatctagccgttcaagccaggaaata
gaaacctcaagttgccttgatagcctgtcctccaaaagcagtcctgtgagtcagggaagt
tctgttagcctcaattccaatgactcagccatgctgaaaagcatacagaacacgctgaaa
aacaagacaagaccgtcggagaacatggactccagatttctcatgcctgaagcctacccc
agctcccccagaaaagctcttcgcagaatacgccagcgaagcaacagtgatatcaccata
agtgaacttgatgtggatagctttgatgaatgtatctcacctacatacaagactggacca
tcactgcacagggaatatggtagcacatcttcaattgataaacagggaacatctggagaa
agcttttttgatttgttaaagggctacaaagatgacaaatctgatcgaggtccaactcca
accaagctcagtgactttctcattactggtggtggcaagggttctggtttctctttggat
gtaatagacgggcctatctcacagagagagaacctcaggctttttaaggaaagggaaaaa
ccactcaagcgacgttcaaaatctgaaactggagactcatctatttttcgtaaattgcgc
aatgccaaaggtgaagaacttgggaagtcatcagatcttgaagataaccgatcagaagac
tctgtcaggccctggacatgtccaaagtgctttgcccactatgatgtccagagtatatta
tttgatttgaatgaggcaattatgaacaggcacaatgttattaagaggagaaacaccacc
actggagcttccgcagctgccgtggcatccttggtctctggacctctgtctcattcagcc
agttttagctccccaatgggcagcacagaggacctgaattccaaaggaagcctcagcatg
gaccagggagatgataaaagcaatgagcttgtaatgagctgtccatattttcggaatgag
ataggtggagaaggggagaggaaaatcagcctttcaaaatcaaattctggctcctttagt
ggatgtgaaagtgcctcctttgagtctacccttagttcccattgcacaaatgcaggagtg
gcagtacttgaagtgcccaaggagaacttggtgttgcacctagatagagtgaaaagatac
atcgtggaacacgtagatctgggtgcatactattatagaaaatttttctaccagaaggaa
cactggaactattttggggctgatgagaatcttggtccagtggctgtgagcattcgaagg
gaaaaaccagatgaaatgaaagaaaatggatctccgtacaactaccgaataatttttaga
actagtgagctcatgacactgagaggttcggtcctggaggacgccattccgtcgacagcc
aagcactcgacagccagaggcctgcctctcaaagaagtgctggagcacgtggttcctgag
ctcaatgtccagtgcctgcggttggccttcaacacacccaaggtcacagagcagctcatg
aaactggatgaacaagggctgaactaccagcagaaagtaggcatcatgtactgcaaagct
ggacagagcactgaagaagagatgtacaacaatgagtcagctggcccagcctttgaagaa
tttcttcaactattgggagagcgagttcggctcaaaggatttgagaagtatcgagcacag
cttgataccaaaactgactccactggaacccattctctgtacacaacatacaaagattat
gaaattatgttccatgtttctaccatgctgccatacacacccaacaacaaacaacagctc
ctgaggaagcggcacattggaaatgatatcgtaacaattgttttccaagagcctggagca
cagccattcagcccaaaaaacatccgatcccacttccagcacgttttcgtcatcgtcagg
gtgcacaatccgtgctctgacagtgtctgttatagtgtggctgttaccaggtccagagat
gtgccttcctttgggcctcccattcctaaaggggtcactttccctaagtcaaatgtgttc
agggacttccttttggcgaaagtgattaatgcagaaaatgctgctcataaatcggagaag
tttcgggccatggcaactcggacccgccaggaatacctgaaagatctggcagaaaagaat
gtcaccaacacccctatcgacccttctggcaagtttccgttcatctctctggcttccaag
aagaaggaaaagtctaagccatatccaggagccgagctcagcagcatgggggccattgta
tgggcagtccgggctgaagactacaacaaggccatggaactagactgccttttagggatc
tccaatgagttcattgtgctcattgaacaggaaacaaagagcgtggtcttcaattgttcc
tgtagagatgtgatagggtggacttcaactgacaccagcctcaaaatcttctatgaacga
ggagaatgtgtttcagtgggtagttttattaacattgaggagatcaaagagattgtcaaa
aggttgcagtttgtttcaaaaggctgtgaatcggtggagatgactctgcgaagaaatggg
ctaggacagcttggcttccatgtcaactatgagggcattgtggcggatgtggagccctac
ggttatgcctggcaggcagggctgaggcagggcagtcgcctggtggagatctgcaaggtg
gcggtagccactctgagccatgagcagatgatcgacctcctgagaacatctgtcacggtg
aaggttgtcatcattcccccgcatgatgactgcaccccgcggaggagttgctctgaaacc
taccgcatgccagtgatggagtacaaaatgaatgaaggtgtttcatacgaattcaagttt
cccttccgaaataataacaagtggcagaggaacgccagcaaggggcctcattcacctcaa
gtcccgtcccaggtgcagagtcccatgacctcgcggctgaatgctggaaaaggagatggg
aagatgcctcctccagaaagagccgccaacatccctcgaagcatctccagtgacgggcgc
ccactagagaggcggctgtctcctggttcggacatctatgtgacggtctcatccatggct
ttagcaagatcccagtgtcggaactctcctagcaacttgtcttcatccagtgatactggt
tctgtggggggcacttacaggcagaagtccatgcccgaagggtttggagtgagccgtaga
tccccagcctccattgacaggcagaacacccagtcagatattggtggcagcggaaaatcc
acgcctagctggcaaagaagtgaggatagcattgctgaccagatggcttacagttataga
ggacctcaggatttcaattcttttgtcctcgagcagcatgaatatacagagccaacatgc
catctcccagcagtatcaaaggtactgccagctttccgagagagccccagtgggagatta
atgcggcaggatccagtggttcatttgtctccaaacaaacaagggcattctgatagccac
tactcgagccactccagtagcaatactctctccagcaatgcgtcaagtgcccatagtgat
gagaagtggtacgatggggaccgcacagaatccgaactcaacagctataactatctgcaa
ggcacctctgctgacagtggcattgacaccacctcttatggccccagccacggcagcaca
gcctcgctgggggctgccacatcgtcacctcgctcagggccaggcaaggagaaagtggca
cccctatggcacagctccagtgaagtaatctccatggcagatcggactttggagacagag
agccacggcctggaccggaaaacagagtcttccctgagcttagacatacacagcaagagc
caagccggctcgacccctctgacaagggagaacagcaccttcagtataaacgatgctgct
tcccacacaagtaccatgagctcccgacactctgccagcccagtggttttcaccagtgcc
cggagttcacctaaagaagagcttcatccagctgccccctcacagctcgcaccatccttc
tcctcctcttcctcctcctcctctggtcctaggagtttttaccctcgccagggcgctact
agcaagtacctgattggatggaaaaaacccgaaggaaccataaactccgtgggatttatg
gacacgagaaagcgtcatcagagcgatggcaatgaaatagcccacaccaggctgcgtgcc
tcaaccagagacctccgggcatctcctaagccaacctccaagtccaccattgaagaagat
ctaaagaaactaattgatcttgaaagcccaactcctgaatcacagaagagttttaagttc
cacgcactctcctctcctcagtctcctttccccagcacccccacctcacggcgggccttg
cacagaacactgtcggacgagagcatttacaatagccagagggagcactttttcacctcc
agggcgtcacttctggaccaagccctgcccaacgacgtcctcttcagtagcacgtaccct
tctctccccaagtcgctcccgttgaggaggccttcttacaccttaggaatgaaatcgctg
catggagagttctcagcctcggacagctccctcactgacatccaggagacccgcaggcag
cctatgcccgaccctggcctgatgcccctgcctgacactgctgcagacttggattggtcc
aacctggtagatgctgccaaagcctatgaggtccagagagcctcattttttgctgctagt
gatgaaaaccatcgccccttgagtgctgcatccaacagtgatcagctggaggaccaggct
ctggcccagatgaagccttacagcagcagtaaagactcctctcccactctggcttctaaa
gtggaccagctggaaggtatgctgaagatgcttcgggaagatttgaagaaggaaaaagaa
gacaaagctcaccttcaggcggaggtgcagcacctgcgagaggacaacctgaggctacag
gaggagtcccagaacgcctcggacaagctgaagaagttcacagaatgggtcttcaacacc
atagacatgagctag

DBGET integrated database retrieval system