KEGG   Homo sapiens (human): 26091
Entry
26091             CDS       T01001                                 
Symbol
HERC4
Name
(RefSeq) HECT and RLD domain containing E3 ubiquitin protein ligase 4
  KO
K10615  E3 ubiquitin-protein ligase HERC4 [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    26091 (HERC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    26091 (HERC4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     26091 (HERC4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   26091 (HERC4)
SSDB
Motif
Pfam: RCC1 HECT RCC1_2 LAIKA
Other DBs
NCBI-GeneID: 26091
NCBI-ProteinID: NP_071362
OMIM: 609248
HGNC: 24521
Ensembl: ENSG00000148634
Pharos: Q5GLZ8(Tbio)
UniProt: Q5GLZ8
LinkDB
Position
10:complement(67921905..68075283)
AA seq 1057 aa
MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVLDDGTVYTCGC
NDLGQLGHEKSRKKPEQVVALDAQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLGLVG
SEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGLGTDCKKQTS
PQLLKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGLNDENDRYVPNLLKSLR
SQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSHEINPRKVFELMGSIVTEIA
CGRQHTSAFVPSSGRIYSFGLGGNGQLGTGSTSNRKSPFTVKGNWYPYNGQCLPDIDSEE
YFCVKRIFSGGDQSFSHYSSPQNCGPPDDFRCPNPTKQIWTVNEALIQKWLSYPSGRFPV
EIANEIDGTFSSSGCLNGSFLAVSNDDHYRTGTRFSGVDMNAARLLFHKLIQPDHPQISQ
QVAASLEKNLIPKLTSSLPDVEALRFYLTLPECPLMSDSNNFTTIAIPFGTALVNLEKAP
LKVLENWWSVLEPPLFLKIVELFKEVVVHLLKLYKIGIPPSERRIFNSFLHTALKVLEIL
HRVNEKMGQIIQYDKFYIHEVQELIDIRNDYINWVQQQAYGMDVNHGLTELADIPVTICT
YPFVFDAQAKTTLLQTDAVLQMQMAIDQAHRQNVSSLFLPVIESVNPCLILVVRRENIVG
DAMEVLRKTKNIDYKKPLKVIFVGEDAVDAGGVRKEFFLLIMRELLDPKYGMFRYYEDSR
LIWFSDKTFEDSDLFHLIGVICGLAIYNCTIVDLHFPLALYKKLLKKKPSLDDLKELMPD
VGRSMQQLLDYPEDDIEETFCLNFTITVENFGATEVKELVLNGADTAVNKQNRQEFVDAY
VDYIFNKSVASLFDAFHAGFHKVCGGKVLLLFQPNELQAMVIGNTNYDWKELEKNTEYKG
EYWAEHPTIKIFWEVFHELPLEKKKQFLLFLTGSDRIPILGMKSLKLVIQSTGGGEEYLP
VSHTCFNLLDLPKYTEKETLRSKLIQAIDHNEGFSLI
NT seq 3174 nt   +upstreamnt  +downstreamnt
atgttgtgctggggaaatgcatcctttgggcagctaggtttgggtggaattgatgaagaa
attgtactagagcccagaaaaagtgacttctttataaataaaagggtccgagatgtagga
tgtggactcagacatactgtgtttgttctggatgatggaacagtgtacacatgtggatgt
aatgatctaggacagctaggtcatgaaaaatccagaaagaaaccagagcaggttgttgcc
ctggatgcccaaaatattgtagctgtttcatgtggagaagctcatacgttagcgctaaat
gacaaaggccaggtgtatgcttggggtctcgattctgatggacagcttggcctggtagga
tcagaggaatgcatcagagtacccagaaatattaaaagtttgtcagatatccagattgta
caggttgcttgtggttactatcattcacttgcactttctaaagcaagtgaagtcttctgt
tggggacagaataaatatggccaattgggtttaggtactgactgtaaaaagcaaacttca
ccgcagctgcttaagtctttgcttggaatccctttcatgcaagttgcagcaggaggagcc
catagttttgtactcaccctttctggagctatctttggatggggacgcaacaagtttggt
cagctaggtcttaatgatgaaaatgataggtatgttcctaatttactaaagtcactaaga
tctcagaaaatagtttatatttgttgtggagaagatcatactgctgctctaaccaaggaa
ggtggagtgtttacttttggagctggagggtatggtcagttgggccataattctaccagt
catgaaataaacccaaggaaagtttttgaacttatgggaagcattgtcactgagattgct
tgtggacggcagcacacttctgcttttgttccttcatcaggacgaatttactcttttggg
cttggtggtaatgggcagctgggaaccggttcaacaagcaacaggaaaagcccctttact
gtaaaaggaaattggtacccctataatgggcagtgtctaccagatattgattctgaagaa
tatttctgtgtaaaaagaattttctcagggggagatcaaagcttttcacattactctagt
ccccagaactgtgggccaccagatgacttcagatgtcccaatccgacaaagcagatctgg
acagtgaatgaagctctaattcagaaatggctgagctatccttctggaaggtttcctgtg
gagatagccaatgagatagatggaacgttttcttcctctggttgcctaaatggaagtttt
ttagctgttagcaatgatgatcactatagaacaggtaccagattttcaggggttgatatg
aatgctgctaggcttttattccacaaacttatacaacctgatcatccgcagatatctcag
caggtggcagctagtttggaaaagaatcttattcctaaactgactagctccttacctgat
gttgaagcattgaggttttatcttactctaccagaatgtcccctgatgagtgattccaac
aatttcacaacaatagcaattccctttggtacagctcttgtgaacctagaaaaggcacca
ctgaaagtacttgaaaactggtggtcagtacttgaacctccactattcctcaagatagta
gaactttttaaggaagttgtggtacatcttttgaaactctacaagatcggtattccccct
tctgaaagaagaattttcaacagttttcttcatactgcattaaaggttttagaaatacta
catagggtaaatgagaaaatgggacagattatacagtatgataaattttatatacatgaa
gtacaagaattgatagacataagaaatgattatatcaactgggtccaacagcaggcctat
ggaatggatgtcaaccatggattaactgagttggcagatatccctgttacaatctgtaca
tatccatttgtatttgatgcccaagcaaaaactactctgttacagaccgatgcagtctta
cagatgcagatggctattgatcaggcccacaggcagaatgtctcctctctttttctccca
gtgattgaatctgtgaatccctgcttaattctagtggtgcgtagagaaaatattgtagga
gatgcaatggaagtccttaggaaaacaaagaacatagattacaagaagccactcaaggtt
atatttgttggagaagatgctgtggatgcaggaggggtgcgcaaagaatttttcttgctc
atcatgagggaattattggatcctaaatacggcatgtttaggtattatgaagattccagg
ctcatttggttttctgataagacatttgaagacagtgatttgttccatttgattggtgtt
atctgtggcttagcaatttataattgtaccattgtggacctccattttcctttggcttta
tataagaaactactgaaaaagaagccatccttggatgatttgaaagaactaatgcctgat
gttgggagaagcatgcaacagttactggattatccagaagatgacatagaggaaacattt
tgtcttaattttacgatcacagttgaaaactttggtgcaacagaagtgaaagagctggtt
ctaaatggtgcagacacagctgttaacaaacaaaatcggcaagagtttgtcgatgcttat
gtggattacatattcaataaatcagtggcttccttatttgatgcttttcatgcgggcttt
cataaggtctgtggaggaaaagtccttctgctctttcagcctaatgaactacaagcaatg
gtcattggaaatacaaattatgattggaaggaactggaaaagaatacagaatacaaaggg
gaatattgggcagaacatcctacgataaaaattttttgggaagtatttcacgaattacca
ttggaaaagaagaaacagtttctgttatttttgacaggtagtgatcgcattcctattctt
ggtatgaagagtctgaaactagtcatccagtccacaggaggtggtgaggagtatctccca
gtttcccatacttgttttaatcttctggatcttccaaaatatacagaaaaagaaactcta
cgctctaaactgatccaagctattgatcacaatgaaggcttcagtttaatataa

DBGET integrated database retrieval system