KEGG   Homo sapiens (human): 26259
Entry
26259             CDS       T01001                                 
Symbol
FBXW8, FBW6, FBW8, FBX29, FBXO29, FBXW6
Name
(RefSeq) F-box and WD repeat domain containing 8
  KO
K10264  F-box and WD-40 domain protein 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    26259 (FBXW8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    26259 (FBXW8)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     26259 (FBXW8)
   Cul7 complex
    Target recognizing subunit
     26259 (FBXW8)
SSDB
Motif
Pfam: F-box-like F-box Nup160
Other DBs
NCBI-GeneID: 26259
NCBI-ProteinID: NP_699179
OMIM: 609073
HGNC: 13597
Ensembl: ENSG00000174989
Pharos: Q8N3Y1(Tbio)
UniProt: Q8N3Y1
Structure
LinkDB
Position
12:116910950..117031148
AA seq 598 aa
MDDYSLDEFRRRWQEELAQAQAPKKRRRPEAAERRARRPEVGSGRGEQASGDPALAQRLL
EGAGRPPAARATRAEGQDVASRSRSPLAREGAGGGEQLVDQLIRDLNEMNDVPFFDIQLP
YELAINIFQYLDRKELGRCAQVSKTWKVIAEDEVLWYRLCQQEGHLPDSSISDYSCWKLI
FQECRAKEHMLRTNWKNRKGAVSELEHVPDTVLCDVHSHDGVVIAGYTSGDVRVWDTRTW
DYVAPFLESEDEEDEPGMQPNVSFVRINSSLAVAAYEDGFLNIWDLRTGKYPVHRFEHDA
RIQALALSQDDATVATASAFDVVMLSPNEEGYWQIAAEFEVPKLVQYLEIVPETRRYPVA
VAAAGDLMYLLKAEDSARTLLYAHGPPVTCLDVSANQVAFGVQGLGWVYEGSKILVYSLE
AGRRLLKLGNVLRDFTCVNLSDSPPNLMVSGNMDGRVRIHDLRSGNIALSLSAHQLRVSA
VQMDDWKIVSGGEEGLVSVWDYRMNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRN
ADLDSFTTHRRHRGLIRAYEFAVDQLAFQSPLPVCRSSCDAMATHYYDLALAFPYNHV
NT seq 1797 nt   +upstreamnt  +downstreamnt
atggacgactacagcctggatgagttccgtcggcgctggcaggaggagctggcgcaggcc
caggcgccgaagaagcggcgacggcccgaggctgccgagaggcgggctcggcggccggag
gtgggctccgggcgcggcgaacaggcctcgggggacccggcgctggcccagcgtctcctg
gagggcgcggggaggcccccggcggcgcgggcgactcgggccgaggggcaggacgtagcg
agccgctcacgttctcctctggcccgcgagggcgccgggggcggggagcagctggtggac
cagctcatccgcgacctgaatgaaatgaatgatgtgcctttctttgatatccaactgcct
tacgaattggcaatcaatatatttcagtatctggacaggaaagaactaggaagatgtgca
caggtgagcaagacgtggaaggtgattgcagaggatgaggtgctgtggtacaggctgtgc
cagcaggaagggcaccttccggatagcagcatctctgactattcttgctggaagctcatc
ttccaagagtgccgagccaaggaacacatgttacgaaccaactggaagaatcgcaaaggt
gccgtgagcgagctggagcatgttcctgacacagttttgtgtgatgtgcattctcacgat
ggtgtggtcattgcgggatatacatcaggggatgtgagagtgtgggacacccgcacctgg
gactacgtagcccccttcctggaatcagaggacgaggaggatgagcctggaatgcagcca
aatgtctcctttgtgaggataaacagctcgttggcagtagcagcttatgaggatgggttt
cttaatatttgggatttaaggaccggaaagtaccctgttcatcgttttgagcacgatgca
agaatacaggcactagccctcagccaggacgatgcaaccgtggccacagcttctgctttt
gatgtcgtgatgttatcccccaatgaggaggggtactggcagatagctgcggaatttgaa
gttccgaaactggttcagtaccttgaaatagttccagaaaccagaaggtaccctgtggca
gtagccgctgctggagatctgatgtacctgctcaaagccgaagactccgccagaaccctc
ctttacgcccacggcccgcctgtcacatgtctagacgtctcggccaaccaagttgctttt
ggtgtacagggtctgggatgggtgtacgaaggaagcaagatcctggtgtatagcctggaa
gcaggacgccgcctcttgaagctgggtaacgttctccgtgacttcacgtgtgtcaacctc
agcgacagccctcccaacctcatggtcagtggcaacatggacgggagggtgaggatccac
gacctccgcagtggtaacatcgccctgtcgctctccgcccatcagctcagggtctctgct
gtgcagatggatgactggaagatcgtcagtggaggcgaggaaggcctggtgtccgtgtgg
gattatcggatgaaccagaagctgtgggaggtgtattccgggcacccggtgcagcacatc
tcattcagcagccacagcctcatcacggccaacgtgccttaccagacggtaatgcgaaac
gccgacctggacagcttcactactcacaggagacaccgggggctgatccgcgcctatgag
tttgcggtggaccagctggccttccagagccctctccctgtctgccgttcatcctgtgac
gccatggccactcactactacgacctcgcactggcctttccctataaccatgtttag

DBGET integrated database retrieval system