KEGG   Homo sapiens (human): 26471
Entry
26471             CDS       T01001                                 
Symbol
NUPR1, COM1, P8
Name
(RefSeq) nuclear protein 1, transcriptional regulator
  KO
K15626  nuclear protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00142  SYT-SSX fusion to transcriptional repression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    26471 (NUPR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    26471 (NUPR1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Other transcription factors
   NUPR
    26471 (NUPR1)
SSDB
Motif
Pfam: Phospho_p8
Other DBs
NCBI-GeneID: 26471
NCBI-ProteinID: NP_036517
OMIM: 614812
HGNC: 29990
Ensembl: ENSG00000176046
Vega: OTTHUMG00000131764
Pharos: O60356(Tbio)
UniProt: O60356 A0A024QZC4
LinkDB
Position
16:complement(28532708..28538974)
AA seq 82 aa
MATFPPATSAPQQPPGPEDEDSSLDESDLYSLAHSYLGGGGRKGRTKREAAANTNRPSPG
GHERKLVTKLQNSERKKRGARR
NT seq 249 nt   +upstreamnt  +downstreamnt
atggccaccttcccaccagcaaccagcgccccccagcagcccccaggcccggaggacgag
gactccagcctggatgaatctgacctctatagcctggcccattcctacctcggaggtgga
ggccggaaaggtcgcaccaagagagaagctgctgccaacaccaaccgccccagccctggc
gggcacgagaggaaactggtgaccaagctgcagaattcagagaggaagaagcgaggggca
cggcgctga

DBGET integrated database retrieval system