KEGG   Homo sapiens (human): 26524
Entry
26524             CDS       T01001                                 
Symbol
LATS2, KPM
Name
(RefSeq) large tumor suppressor kinase 2
  KO
K08791  serine/threonine-protein kinase LATS1/2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    26524 (LATS2)
   04392 Hippo signaling pathway - multiple species
    26524 (LATS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    26524 (LATS2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     26524 (LATS2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  NDR family
   26524 (LATS2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C ABC1 UBA APH Pox_ser-thr_kin CBP66 Haspin_kinase Kdo Kinase-like
Other DBs
NCBI-GeneID: 26524
NCBI-ProteinID: NP_055387
OMIM: 604861
HGNC: 6515
Ensembl: ENSG00000150457
Vega: OTTHUMG00000016531
Pharos: Q9NRM7(Tchem)
UniProt: Q9NRM7 A0A024RDM3
Structure
LinkDB
Position
13:complement(20973036..21061586)
AA seq 1088 aa
MRPKTFPATTYSGNSRQRLQEIREGLKQPSKSSVQGLPAGPNSDTSLDAKVLGSKDATRQ
QQQMRATPKFGPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQELVNAGCDQEMAGRA
LKQTGSRSIEAALEYISKMGYLDPRNEQIVRVIKQTSPGKGLMPTPVTRRPSFEGTGDSF
ASYHQLSGTPYEGPSFGADGPTALEEMPRPYVDYLFPGVGPHGPGHQHQHPPKGYGASVE
AAGAHFPLQGAHYGRPHLLVPGEPLGYGVQRSPSFQSKTPPETGGYASLPTKGQGGPPGA
GLAFPPPAAGLYVPHPHHKQAGPAAHQLHVLGSRSQVFASDSPPQSLLTPSRNSLNVDLY
ELGSTSVQQWPAATLARRDSLQKPGLEAPPRAHVAFRPDCPVPSRTNSFNSHQPRPGPPG
KAEPSLPAPNTVTAVTAAHILHPVKSVRVLRPEPQTAVGPSHPAWVPAPAPAPAPAPAPA
AEGLDAKEEHALALGGAGAFPLDVEYGGPDRRCPPPPYPKHLLLRSKSEQYDLDSLCAGM
EQSLRAGPNEPEGGDKSRKSAKGDKGGKDKKQIQTSPVPVRKNSRDEEKRESRIKSYSPY
AFKFFMEQHVENVIKTYQQKVNRRLQLEQEMAKAGLCEAEQEQMRKILYQKESNYNRLKR
AKMDKSMFVKIKTLGIGAFGEVCLACKVDTHALYAMKTLRKKDVLNRNQVAHVKAERDIL
AEADNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEVFPEHLARFYIAELTLAIE
SVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGSHVRQDSMEPSD
LWDDVSNCRCGDRLKTLEQRARKQHQRCLAHSLVGTPNYIAPEVLLRKGYTQLCDWWSVG
VILFEMLVGQPPFLAPTPTETQLKVINWENTLHIPAQVKLSPEARDLITKLCCSADHRLG
RNGADDLKAHPFFSAIDFSSDIRKQPAPYVPTISHPMDTSNFDPVDEESPWNDASEGSTK
AWDTLTSPNNKHPEHAFYEFTFRRFFDDNGYPFRCPKPSGAEASQAESSDLESSDLVDQT
EGCQPVYV
NT seq 3267 nt   +upstreamnt  +downstreamnt
atgaggccaaagacttttcctgccacgacttattctggaaatagccggcagcgactgcaa
gagattcgtgaggggttaaaacagccatccaagtcttcggttcaggggctacccgcagga
ccaaacagtgacacttccctggatgccaaagtcctggggagcaaagatgccaccaggcag
cagcagcagatgagagccaccccaaagttcggaccttatcagaaagccttgagggaaatc
agatattccttgttgccttttgctaatgaatcgggcacctctgcagctgcagaagtgaac
cggcaaatgctgcaggaactggtgaacgcaggatgcgaccaggagatggctggccgagct
ctcaagcagactggcagcaggagcatcgaggccgccctggagtacatcagcaagatgggc
tacctggacccgaggaatgagcagattgtgcgggtcattaagcagacctccccaggaaag
gggctcatgccaaccccagtgacgcggaggcccagcttcgaaggaaccggcgattcgttt
gcgtcctaccaccagctgagcggtaccccctacgagggcccaagcttcggcgctgacggc
cccacggcgctggaggagatgccgcggccgtacgtggactaccttttccccggagtcggc
ccccacgggcccggccaccagcaccagcacccacccaagggctacggtgccagcgtagag
gcagcaggggcacacttcccgctgcagggcgcgcactacgggcggccgcacctgctggtg
cctggggaacccctgggctacggagtgcagcgcagcccctccttccagagcaagacgccg
ccggagaccgggggttacgccagcctgcccacgaagggccagggaggaccgccaggcgcc
ggcctcgctttcccaccccctgccgccgggctctacgtgccgcacccacaccacaagcag
gccggtcccgcggcccaccagctgcatgtgctgggctcccgcagccaggtgttcgccagc
gacagccccccgcagagcctgctcactccctcgcggaacagcctcaacgtggacctgtat
gaattgggcagcacctccgtccagcagtggccggctgccaccctggcccgccgggactcc
ctgcagaagccgggcctggaggcgccgccgcgcgcgcacgtggccttccggcctgactgc
ccagtgcccagcaggaccaactccttcaacagccaccagccgcggcccggtccgcctggc
aaggccgagccctccctgcccgcccccaacaccgtgacggctgtcacggccgcgcacatc
ttgcacccggtgaagagcgtgcgtgtgctgaggccggagccgcagacggctgtggggccc
tcgcaccccgcctgggtgcccgcgcctgccccggcccccgcccccgcccccgccccggct
gcggagggcttggacgccaaggaggagcatgccctggcgctgggcggcgcaggcgccttc
ccgctggacgtggagtacggaggcccagaccggaggtgcccgcctccgccctacccgaag
cacctgctgctgcgcagcaagtcggagcagtacgacctggacagcctgtgcgcaggcatg
gagcagagcctccgtgcgggccccaacgagcccgagggcggcgacaagagccgcaaaagc
gccaagggggacaaaggcggaaaggataaaaagcagattcagacctctcccgttcccgtc
cgcaaaaacagcagagacgaagagaagagagagtcacgcatcaagagctactcgccatac
gcctttaagttcttcatggagcagcacgtggagaatgtcatcaaaacctaccagcagaag
gttaaccggaggctgcagctggagcaagaaatggccaaagctggactctgtgaagctgag
caggagcagatgcggaagatcctctaccagaaagagtctaattacaacaggttaaagagg
gccaagatggacaagtctatgtttgtcaagatcaaaaccctggggatcggtgcctttgga
gaagtgtgccttgcttgtaaggtggacactcacgccctgtacgccatgaagaccctaagg
aaaaaggatgtcctgaaccggaatcaggtggcccacgtcaaggccgagagggacatcctg
gccgaggcagacaatgagtgggtggtcaaactctactactccttccaagacaaagacagc
ctgtactttgtgatggactacatccctggtggggacatgatgagcctgctgatccggatg
gaggtcttccctgagcacctggcccggttctacatcgcagagctgactttggccattgag
agtgtccacaagatgggcttcatccaccgagacatcaagcctgataacattttgatagat
ctggatggtcacattaaactcacagatttcggcctctgcactgggttcaggtggactcac
aattccaaatattaccagaaagggagccatgtcagacaggacagcatggagcccagcgac
ctctgggatgatgtgtctaactgtcggtgtggggacaggctgaagaccctagagcagagg
gcgcggaagcagcaccagaggtgcctggcacattcactggtggggactccaaactacatc
gcacccgaggtgctcctccgcaaagggtacactcaactctgtgactggtggagtgttgga
gtgattctcttcgagatgctggtggggcagccgccctttttggcacctactcccacagaa
acccagctgaaggtgatcaactgggagaacacgctccacattccagcccaggtgaagctg
agccctgaggccagggacctcatcaccaagctgtgctgctccgcagaccaccgcctgggg
cggaatggggccgatgacctgaaggcccaccccttcttcagcgccattgacttctccagt
gacatccggaagcagccagccccctacgttcccaccatcagccaccccatggacacctcg
aatttcgaccccgtagatgaagaaagcccttggaacgatgccagcgaaggtagcaccaag
gcctgggacacactcacctcgcccaataacaagcatcctgagcacgcattttacgaattc
accttccgaaggttctttgatgacaatggctacccctttcgatgcccaaagccttcagga
gcagaagcttcacaggctgagagctcagatttagaaagctctgatctggtggatcagact
gaaggctgccagcctgtgtacgtgtag

KEGG   Homo sapiens (human): 9113
Entry
9113              CDS       T01001                                 
Symbol
LATS1, WARTS, wts
Name
(RefSeq) large tumor suppressor kinase 1
  KO
K08791  serine/threonine-protein kinase LATS1/2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    9113 (LATS1)
   04392 Hippo signaling pathway - multiple species
    9113 (LATS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9113 (LATS1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9113 (LATS1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  NDR family
   9113 (LATS1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr UBA ABC1 Cas_Cas6_C APH EcoEI_R_C Haspin_kinase Pkinase_C Kinase-like UBA_3
Other DBs
NCBI-GeneID: 9113
NCBI-ProteinID: NP_004681
OMIM: 603473
HGNC: 6514
Ensembl: ENSG00000131023
Vega: OTTHUMG00000016437
Pharos: O95835(Tbio)
UniProt: O95835
Structure
LinkDB
Position
6:complement(149658153..149718101)
AA seq 1130 aa
MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTE
DPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEDMVI
QALQKTNNRSIEAAIEFISKMSYQDPRREQMAAAAARPINASMKPGNVQQSVNRKQSWKG
SKESLVPQRHGPPLGESVAYHSESPNSQTDVGRPLSGSGISAFVQAHPSNGQRVNPPPPP
QVRSVTPPPPPRGQTPPPRGTTPPPPSWEPNSQTKRYSGNMEYVISRISPVPPGAWQEGY
PPPPLNTSPMNPPNQGQRGISSVPVGRQPIIMQSSSKFNFPSGRPGMQNGTGQTDFMIHQ
NVVPAGTVNRQPPPPYPLTAANGQSPSALQTGGSAAPSSYTNGSIPQSMMVPNRNSHNME
LYNISVPGLQTNWPQSSSAPAQSSPSSGHEIPTWQPNIPVRSNSFNNPLGNRASHSANSQ
PSATTVTAITPAPIQQPVKSMRVLKPELQTALAPTHPSWIPQPIQTVQPSPFPEGTASNV
TVMPPVAEAPNYQGPPPPYPKHLLHQNPSVPPYESISKPSKEDQPSLPKEDESEKSYENV
DSGDKEKKQITTSPITVRKNKKDEERRESRIQSYSPQAFKFFMEQHVENVLKSHQQRLHR
KKQLENEMMRVGLSQDAQDQMRKMLCQKESNYIRLKRAKMDKSMFVKIKTLGIGAFGEVC
LARKVDTKALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYF
VMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDG
HIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWGDPSSCRCGDRLKPLERRAAR
QHQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQM
KVINWQTSLHIPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLR
QQSASYIPKITHPTDTSNFDPVDPDKLWSDDNEEENVNDTLNGWYKNGKHPEHAFYEFTF
RRFFDDNGYPYNYPKPIEYEYINSQGSEQQSDEDDQNTGSEIKNRDLVYV
NT seq 3393 nt   +upstreamnt  +downstreamnt
atgaagaggagtgaaaagccagaaggatatagacaaatgaggcctaagacctttcctgcc
agtaactatactgtcagtagccggcaaatgttacaagaaattcgggaatcccttaggaat
ttatctaaaccatctgatgctgctaaggctgagcataacatgagtaaaatgtcaaccgaa
gatcctcgacaagtcagaaatccacccaaatttgggacgcatcataaagccttgcaggaa
attcgaaactctctgcttccatttgcaaatgaaacaaattcttctcggagtacttcagaa
gttaatccacaaatgcttcaagacttgcaagctgctggatttgatgaggatatggttata
caagctcttcagaaaactaacaacagaagtatagaagcagcaattgaattcattagtaaa
atgagttaccaagatcctcgacgagagcagatggctgcagcagctgccagacctattaat
gccagcatgaaaccagggaatgtgcagcaatcagttaaccgcaaacagagctggaaaggt
tctaaagaatccttagttcctcagaggcatggcccgccactaggagaaagtgtggcctat
cattctgagagtcccaactcacagacagatgtaggaagacctttgtctggatctggtata
tcagcatttgttcaagctcaccctagcaacggacagagagtgaaccccccaccaccacct
caagtaaggagtgttactcctccaccacctccaagaggccagactccccctccaagaggt
acaactccacctcccccttcatgggaaccaaactctcaaacaaagcgctattctggaaac
atggaatacgtaatctcccgaatctctcctgtcccacctggggcatggcaagagggctat
cctccaccacctctcaacacttcccccatgaatcctcctaatcaaggacagagaggcatt
agttctgttcctgttggcagacaaccaatcatcatgcagagttctagcaaatttaacttt
ccatcagggagacctggaatgcagaatggtactggacaaactgatttcatgatacaccaa
aatgttgtccctgctggcactgtgaatcggcagccaccacctccatatcctctgacagca
gctaatggacaaagcccttctgctttacaaacagggggatctgctgctccttcgtcatat
acaaatggaagtattcctcagtctatgatggtgccaaacagaaatagtcataacatggaa
ctatataacattagtgtacctggactgcaaacaaattggcctcagtcatcttctgctcca
gcccagtcatccccgagcagtgggcatgaaatccctacatggcaacctaacataccagtg
aggtcaaattcttttaataacccattaggaaatagagcaagtcactctgctaattctcag
ccttctgctacaacagtcactgcaattacaccagctcctattcaacagcctgtgaaaagt
atgcgtgtattaaaaccagagctacagactgctttagcacctacacacccttcttggata
ccacagccaattcaaactgttcaacccagtccttttcctgagggaaccgcttcaaatgtg
actgtgatgccacctgttgctgaagctccaaactatcaaggaccaccaccaccctaccca
aaacatctgctgcaccaaaacccatctgttcctccatacgagtcaatcagtaagcctagc
aaagaggatcagccaagcttgcccaaggaagatgagagtgaaaagagttatgaaaatgtt
gatagtggggataaagaaaagaaacagattacaacttcacctattactgttaggaaaaac
aagaaagatgaagagcgaagggaatctcgtattcaaagttattctcctcaagcatttaaa
ttctttatggagcaacatgtagaaaatgtactcaaatctcatcagcagcgtctacatcgt
aaaaaacaattagagaatgaaatgatgcgggttggattatctcaagatgcccaggatcaa
atgagaaagatgctttgccaaaaagaatctaattacatccgtcttaaaagggctaaaatg
gacaagtctatgtttgtgaagataaagacactaggaataggagcatttggtgaagtctgt
ctagcaagaaaagtagatactaaggctttgtatgcaacaaaaactcttcgaaagaaagat
gttcttcttcgaaatcaagtcgctcatgttaaggctgagagagatatcctggctgaagct
gacaatgaatgggtagttcgtctatattattcattccaagataaggacaatttatacttt
gtaatggactacattcctgggggtgatatgatgagcctattaattagaatgggcatcttt
ccagaaagtctggcacgattctacatagcagaacttacctgtgcagttgaaagtgttcat
aaaatgggttttattcatagagatattaaacctgataatattttgattgatcgtgatggt
catattaaattgactgactttggcctctgcactggcttcagatggacacacgattctaag
tactatcagagtggtgaccatccacggcaagatagcatggatttcagtaatgaatggggg
gatccctcaagctgtcgatgtggagacagactgaagccattagagcggagagctgcacgc
cagcaccagcgatgtctagcacattctttggttgggactcccaattatattgcacctgaa
gtgttgctacgaacaggatacacacagttgtgtgattggtggagtgttggtgttattctt
tttgaaatgttggtgggacaacctcctttcttggcacaaacaccattagaaacacaaatg
aaggttatcaactggcaaacatctcttcacattccaccacaagctaaactcagtcctgaa
gcttctgatcttattattaaactttgccgaggacccgaagatcgcttaggcaagaatggt
gctgatgaaataaaagctcatccattttttaaaacaattgacttctccagtgacctgaga
cagcagtctgcttcatacattcctaaaatcacacacccaacagatacatcaaattttgat
cctgttgatcctgataaattatggagtgatgataacgaggaagaaaatgtaaatgacact
ctcaatggatggtataaaaatggaaagcatcctgaacatgcattctatgaatttaccttc
cgaaggttttttgatgacaatggctacccatataattatccgaagcctattgaatatgaa
tacattaattcacaaggctcagagcagcagtcggatgaagatgatcaaaacacaggctca
gagattaaaaatcgcgatctagtatatgtttaa

DBGET integrated database retrieval system