KEGG   Homo sapiens (human): 2658
Entry
2658              CDS       T01001                                 
Symbol
GDF2, BMP-9, BMP9, HHT5
Name
(RefSeq) growth differentiation factor 2
  KO
K05503  growth differentiation factor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Network
nt06507  TGFB signaling
  Element
N01426  BMP9/10 signaling pathway
Disease
H00533  Hereditary hemorrhagic telangiectasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2658 (GDF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2658 (GDF2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   2658 (GDF2)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 2658
NCBI-ProteinID: NP_057288
OMIM: 605120
HGNC: 4217
Ensembl: ENSG00000263761
Pharos: Q9UK05(Tbio)
UniProt: Q9UK05 B2RC63
Structure
LinkDB
Position
10:47322454..47327588
AA seq 429 aa
MCPGALWVALPLLSLLAGSLQGKPLQSWGRGSAGGNAHSPLGVPGGGLPEHTFNLKMFLE
NVKVDFLRSLNLSGVPSQDKTRVEPPQYMIDLYNRYTSDKSTTPASNIVRSFSMEDAISI
TATEDFPFQKHILLFNISIPRHEQITRAELRLYVSCQNHVDPSHDLKGSVVIYDVLDGTD
AWDSATETKTFLVSQDIQDEGWETLEVSSAVKRWVRSDSTKSKNKLEVTVESHRKGCDTL
DISVPPGSRNLPFFVVFSNDHSSGTKETRLELREMISHEQESVLKKLSKDGSTEAGESSH
EEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGC
FFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEG
MSVAECGCR
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgtgtcctggggcactgtgggtggccctgcccctgctgtccctgctggctggctcccta
caggggaagccactgcagagctggggacgagggtctgctgggggaaacgcccacagccca
ctgggggtgcctggaggtgggctgcctgagcacaccttcaacctgaagatgtttctggag
aacgtgaaggtggatttcctgcgcagccttaacctgagtggggtcccttcgcaggacaaa
accagggtggagccgccgcagtacatgattgacctgtacaacaggtacacgtccgataag
tcgactacgccagcgtccaacattgtgcggagcttcagcatggaagatgccatctccata
actgccacagaggacttccccttccagaagcacatcttgctcttcaacatctccattcct
aggcatgagcagatcaccagagctgagctccgactctatgtctcctgtcaaaatcacgtg
gacccctctcatgacctgaaaggaagcgtggtcatttatgatgttctggatggaacagat
gcctgggatagtgctacagagaccaagaccttcctggtgtcccaggacattcaggatgag
ggctgggagaccttggaagtgtccagcgccgtgaagcgctgggtccggtccgactccacc
aagagcaaaaataagctggaagtgactgtggagagccacaggaagggctgcgacacgctg
gacatcagtgtccccccaggttccagaaacctgcccttctttgttgtcttctccaatgac
cacagcagtgggaccaaggagaccaggctggagctgagggagatgatcagccatgaacaa
gagagcgtgctcaagaagctgtccaaggacggctccacagaggcaggtgagagcagtcac
gaggaggacacggatggccacgtggctgcggggtcgactttagccaggcggaaaaggagc
gccggggctggcagccactgtcaaaagacctccctgcgggtaaacttcgaggacatcggc
tgggacagctggatcattgcacccaaggagtatgaagcctacgagtgtaagggcggctgc
ttcttccccttggctgacgatgtgacgccgacgaaacacgctatcgtgcagaccctggtg
catctcaagttccccacaaaggtgggcaaggcctgctgtgtgcccaccaaactgagcccc
atctccgtcctctacaaggatgacatgggggtgcccaccctcaagtaccattacgagggc
atgagcgtggcagagtgtgggtgcaggtag

DBGET integrated database retrieval system