KEGG   Homo sapiens (human): 2662
Entry
2662              CDS       T01001                                 
Symbol
GDF10, BIP, BMP-3b, BMP3B
Name
(RefSeq) growth differentiation factor 10
  KO
K22674  growth differentiation factor 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2662 (GDF10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2662 (GDF10)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   2662 (GDF10)
SSDB
Motif
Pfam: TGF_beta
Other DBs
NCBI-GeneID: 2662
NCBI-ProteinID: NP_004953
OMIM: 601361
HGNC: 4215
Ensembl: ENSG00000266524
Pharos: P55107(Tbio)
UniProt: P55107
LinkDB
Position
10:47300197..47313577
AA seq 478 aa
MAHVPARTSPGPGPQLLLLLLPLFLLLLRDVAGSHRAPAWSALPAAADGLQGDRDLQRHP
GDAAATLGPSAQDMVAVHMHRLYEKYSRQGARPGGGNTVRSFRARLEVVDQKAVYFFNLT
SMQDSEMILTATFHFYSEPPRWPRALEVLCKPRAKNASGRPLPLGPPTRQHLLFRSLSQN
TATQGLLRGAMALAPPPRGLWQAKDISPIVKAARRDGELLLSAQLDSEERDPGVPRPSPY
APYILVYANDLAISEPNSVAVTLQRYDPFPAGDPEPRAAPNNSADPRVRRAAQATGPLQD
NELPGLDERPPRAHAQHFHKHQLWPSPFRALKPRPGRKDRRKKGQEVFMAASQVLDFDEK
TMQKARRKQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPS
NHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggctcatgtccccgctcggaccagcccgggacccgggccccagctgctgctgctgctg
ctgccgttgtttctgctgttgctccgggatgtggccggcagccacagggcccccgcctgg
tccgcactgcccgcggccgccgacggcctgcagggggacagggatctccagcggcaccct
ggggacgcggccgccacgttgggccccagcgcccaggacatggtcgctgtccacatgcac
aggctctatgagaagtacagccggcagggcgcgcggccgggagggggcaacacggtccgc
agcttcagggccaggctggaagtggtcgaccagaaggccgtgtatttcttcaacctgact
tccatgcaagactcggaaatgatccttacggccactttccacttctactcagagccgcct
cggtggcctcgagcgctcgaggtgctatgcaagccgcgggccaagaacgcttcaggccgc
ccgctgcccctgggcccgcccacacgccagcacctgctcttccgcagcctctcgcagaac
acggccacacaggggctactccgcggggccatggccctggcgcccccaccgcgcggcctg
tggcaggccaaggacatctcccccatcgtcaaggcggcccgccgggatggcgagctgctc
ctctccgcccagctggattctgaggagagggacccgggggtgccccggcccagcccctat
gcgccctacatcctagtctatgccaacgatctggccatctcggagcccaacagcgtggca
gtgacgctgcagagatacgaccccttccctgccggagaccccgagccccgcgcagccccc
aacaactcagcggacccccgcgtgcgccgagccgcgcaggccactgggcccctccaggac
aacgagctgccggggctggatgagaggccgccgcgcgcccacgcacagcacttccacaag
caccagctgtggcccagccccttccgggcgctgaaaccccggccagggcgcaaagaccgc
aggaagaagggccaggaggtgttcatggccgcctcgcaggtgctggactttgacgagaag
acgatgcagaaagcccggaggaagcagtgggatgagccgagggtgtgctcccggaggtac
ctgaaggtggacttcgcagacatcggctggaatgaatggataatctcaccgaaatctttt
gatgcctactactgcgcgggagcatgtgagttccccatgcctaagatcgttcgtccatcc
aaccatgccaccatccagagcattgtcagggctgtgggcatcatccctggcatcccagag
ccctgctgtgttcccgataagatgaactcccttggggtcctcttcctggatgagaatcgg
aatgtggttctgaaggtgtaccccaacatgtccgtggacacctgtgcctgccggtga

DBGET integrated database retrieval system