Homo sapiens (human): 2691 Help Entry 2691              CDS       T01001                                  Symbol GHRH, GHRF, GRF, INN Name (RefSeq) growth hormone releasing hormone   KO K05260   growth hormone-releasing hormone Organism hsa  Homo sapiens (human) Pathway hsa04080   Neuroactive ligand-receptor interaction hsa04935   Growth hormone synthesis, secretion and action Network nt06324  GHRH-GH-IGF signaling   Element N00910   GHRHR-PKA-GH signaling pathway Disease H01700   Hypopituitarism Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     2691 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     2691 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hsa04052]     2691 (GHRH) Cytokines and neuropeptides [BR:hsa04052]  Neuropeptides   Neuropeptides (GPCR binding)    2691 (GHRH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  2691 NCBI-ProteinID:  NP_066567 OMIM:  139190 HGNC:  4265 Ensembl:  ENSG00000118702 CPD:  C16085 UniProt:  P01286 Structure PDBPDBj LinkDB All DBs Position 20:complement(37251086..37261814) Genome browser AA seq 108 aa AA seqDB search MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSR QQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHSRNSQG NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgccactctgggtgttcttctttgtgatcctcaccctcagcaacagctcccactgctcc ccacctccccctttgaccctcaggatgcggcggtatgcagatgccatcttcaccaacagc taccggaaggtgctgggccagctgtccgcccgcaagctgctccaggacatcatgagcagg cagcagggagagagcaaccaagagcgaggagcaagggcacggcttggtcgtcaggtagac agcatgtgggcagaacaaaagcaaatggaattggagagcatcctggtggccctgctgcag aagcacagcaggaactcccagggatga

DBGET integrated database retrieval system