KEGG   Homo sapiens (human): 2695
Entry
2695              CDS       T01001                                 
Symbol
GIP
Name
(RefSeq) gastric inhibitory polypeptide
  KO
K05258  gastric inhibitory polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2695 (GIP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2695 (GIP)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    2695 (GIP)
SSDB
Motif
Pfam: Hormone_2
Other DBs
NCBI-GeneID: 2695
NCBI-ProteinID: NP_004114
OMIM: 137240
HGNC: 4270
Ensembl: ENSG00000159224
Pharos: P09681(Tchem)
CPD: C15906
UniProt: P09681
Structure
LinkDB
Position
17:complement(48958554..48968596)
AA seq 153 aa
MVATKTFALLLLSLFLAVGLGEKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISD
YSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALELASQANRKEEEAVEPQSSPA
KNPSDEDLLRDLLIQELLACLLDQTNLCRLRSR
NT seq 462 nt   +upstreamnt  +downstreamnt
atggtggccacgaagacctttgctctgctgctgctgtccctgttcctggcagtgggacta
ggagagaagaaagagggtcacttcagcgctctcccctccctgcctgttggatctcatgct
aaggtgagcagccctcaacctcgaggccccaggtacgcggaagggactttcatcagtgac
tacagtattgccatggacaagattcaccaacaagactttgtgaactggctgctggcccaa
aaggggaagaagaatgactggaaacacaacatcacccagagggaggctcgggcgctggag
ctggccagtcaagctaataggaaggaggaggaggcagtggagccacagagctccccagcc
aagaaccccagcgatgaagatttgctgcgggacttgctgattcaagagctgttggcctgc
ttgctggatcagacaaacctctgcaggctcaggtctcggtga

DBGET integrated database retrieval system