KEGG   Homo sapiens (human): 27018
Entry
27018             CDS       T01001                                 
Symbol
BEX3, Bex, DXS6984E, HGR74, NADE, NGFRAP1
Name
(RefSeq) brain expressed X-linked 3
  KO
K12465  nerve growth factor receptor-associated protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    27018 (BEX3)
SSDB
Motif
Pfam: BEX
Other DBs
NCBI-GeneID: 27018
NCBI-ProteinID: NP_055195
OMIM: 300361
HGNC: 13388
Ensembl: ENSG00000166681
Pharos: Q00994(Tbio)
UniProt: Q00994
LinkDB
Position
X:103376323..103378164
AA seq 111 aa
MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGM
GGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP
NT seq 336 nt   +upstreamnt  +downstreamnt
atggcaaatattcaccaggaaaacgaagagatggagcagcctatgcagaatggagaggaa
gaccgccctttgggaggaggtgaaggccaccagcctgcaggaaatcgacggggacaggct
cgccgacttgcccctaattttcgatgggccatacccaataggcagatcaatgatgggatg
ggtggagatggagatgatatggaaatattcatggaggagatgagagaaatcagaagaaaa
cttagggagctgcagttgaggaattgtctgcgtatccttatgggggagctctctaatcac
catgaccatcatgatgaattttgccttatgccttga

DBGET integrated database retrieval system