KEGG   Homo sapiens (human): 27030
Entry
27030             CDS       T01001                                 
Symbol
MLH3, HNPCC7
Name
(RefSeq) mutL homolog 3
  KO
K08739  DNA mismatch repair protein MLH3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03430  Mismatch repair
Disease
H00020  Colorectal cancer
H00876  Mismatch repair deficiency
H02565  Hereditary nonpolyposis colorectal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    27030 (MLH3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    27030 (MLH3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     27030 (MLH3)
SSDB
Motif
Pfam: MutL_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 27030
NCBI-ProteinID: NP_001035197
OMIM: 604395
HGNC: 7128
Ensembl: ENSG00000119684
Pharos: Q9UHC1(Tbio)
UniProt: Q9UHC1
LinkDB
Position
14:complement(75013775..75051467)
AA seq 1453 aa
MIKCLSVEVQAKLRSGLAISSLGQCVEELALNSIDAEAKCVAVRVNMETFQVQVIDNGFG
MGSDDVEKVGNRYFTSKCHSVQDLENPRFYGFRGEALANIADMASAVEISSKKNRTMKTF
VKLFQSGKALKACEADVTRASAGTTVTVYNLFYQLPVRRKCMDPRLEFEKVRQRIEALSL
MHPSISFSLRNDVSGSMVLQLPKTKDVCSRFCQIYGLGKSQKLREISFKYKEFELSGYIS
SEAHYNKNMQFLFVNKRLVLRTKLHKLIDFLLRKESIICKPKNGPTSRQMNSSLRHRSTP
ELYGIYVINVQCQFCEYDVCMEPAKTLIEFQNWDTLLFCIQEGVKMFLKQEKLFVELSGE
DIKEFSEDNGFSLFDATLQKRVTSDERSNFQEACNNILDSYEMFNLQSKAVKRKTTAENV
NTQSSRDSEATRKNTNDAFLYIYESGGPGHSKMTEPSLQNKDSSCSESKMLEQETIVASE
AGENEKHKKSFLEHSSLENPCGTSLEMFLSPFQTPCHFEESGQDLEIWKESTTVNGMAAN
ILKNNRIQNQPKRFKDATEVGCQPLPFATTLWGVHSAQTEKEKKKESSNCGRRNVFSYGR
VKLCSTGFITHVVQNEKTKSTETEHSFKNYVRPGPTRAQETFGNRTRHSVETPDIKDLAS
TLSKESGQLPNKKNCRTNISYGLENEPTATYTMFSAFQEGSKKSQTDCILSDTSPSFPWY
RHVSNDSRKTDKLIGFSKPIVRKKLSLSSQLGSLEKFKRQYGKVENPLDTEVEESNGVTT
NLSLQVEPDILLKDKNRLENSDVCKITTMEHSDSDSSCQPASHILNSEKFPFSKDEDCLE
QQMPSLRESPMTLKELSLFNRKPLDLEKSSESLASKLSRLKGSERETQTMGMMSRFNELP
NSDSSRKDSKLCSVLTQDFCMLFNNKHEKTENGVIPTSDSATQDNSFNKNSKTHSNSNTT
ENCVISETPLVLPYNNSKVTGKDSDVLIRASEQQIGSLDSPSGMLMNPVEDATGDQNGIC
FQSEESKARACSETEESNTCCSDWQRHFDVALGRMVYVNKMTGLSTFIAPTEDIQAACTK
DLTTVAVDVVLENGSQYRCQPFRSDLVLPFLPRARAERTVMRQDNRDTVDDTVSSESLQS
LFSEWDNPVFARYPEVAVDVSSGQAESLAVKIHNILYPYRFTKGMIHSMQVLQQVDNKFI
ACLMSTKTEENGEAGGNLLVLVDQHAAHERIRLEQLIIDSYEKQQAQGSGRKKLLSSTLI
PPLEITVTEEQRRLLWCYHKNLEDLGLEFVFPDTSDSLVLVGKVPLCFVEREANELRRGR
STVTKSIVEEFIREQLELLQTTGGIQGTLPLTVQKVLASQACHGAIKFNDGLSLQESCRL
IEALSSCQLPFQCAHGRPSMLPLADIDHLEQEKQIKPNLTKLRKMAQAWRLFGKAECDTR
QSLQQSMPPCEPP
NT seq 4362 nt   +upstreamnt  +downstreamnt
atgatcaagtgcttgtcagttgaagtacaagccaaattgcgttctggtttggccataagc
tccttgggccaatgtgttgaggaacttgccctcaacagtattgatgctgaagcaaaatgt
gtggctgtcagggtgaatatggaaaccttccaagttcaagtgatagacaatggatttggg
atggggagtgatgatgtagagaaagtgggaaatcgttatttcaccagtaaatgccactcg
gtacaggacttggagaatccaaggttttatggtttccgaggagaggccttggcaaatatt
gctgacatggccagtgctgtggaaatttcgtccaagaaaaacaggacaatgaaaactttt
gtgaaactgtttcagagtggaaaagccctgaaagcttgtgaagctgatgtgactagagca
agcgctgggactactgtaacagtgtataacctattttaccagcttcctgtaaggaggaaa
tgcatggaccctagactggagtttgagaaggttaggcagagaatagaagctctctcactc
atgcacccttccatttctttctctttgagaaatgatgtttctggttccatggttcttcag
ctccctaaaaccaaagacgtatgttcccgattttgtcaaatttatggattgggaaagtcc
caaaagctaagagaaataagttttaaatataaagagtttgagcttagtggctatatcagc
tctgaagcacattacaacaagaatatgcagtttttgtttgtgaacaaaagactagtttta
aggacaaagctacataaactcattgactttttattaaggaaagaaagtattatatgcaag
ccaaagaatggtcccaccagtaggcaaatgaattcaagtcttcggcaccggtctacccca
gaactctatggcatatatgtaattaatgtgcagtgccaattctgtgagtatgatgtgtgc
atggagccagccaaaactctgattgaatttcagaactgggacactctcttgttttgcatt
caggaaggagtgaaaatgtttttaaagcaagaaaaattatttgtggaattatcaggtgag
gatattaaggaatttagtgaagataatggttttagtttatttgatgctactcttcagaag
cgtgtgacttccgatgagaggagcaatttccaggaagcatgtaataatattttagattcc
tatgagatgtttaatttgcagtcaaaagctgtgaaaagaaaaactactgcagaaaacgta
aacacacagagttctagggattcagaagctaccagaaaaaatacaaatgatgcatttttg
tacatttatgaatcaggtggtccaggccatagcaaaatgacagagccatctttacaaaac
aaagacagctcttgctcagaatcaaagatgttagaacaagagacaattgtagcatcagaa
gctggagaaaatgagaaacataaaaaatctttcctggaacatagctctttagaaaatccg
tgtggaaccagtttagaaatgtttttaagcccttttcagacaccatgtcactttgaggag
agtgggcaggatctagaaatatggaaagaaagtactactgttaatggcatggctgccaac
atcttgaaaaataatagaattcagaatcaaccaaagagatttaaagatgctactgaagtg
ggatgccagcctctgccttttgcaacaacattatggggagtacatagtgctcagacagag
aaagagaaaaaaaaagaatctagcaattgtggaagaagaaatgtttttagttatgggcga
gttaaattatgttccactggctttataactcatgtagtacaaaatgaaaaaactaaatca
actgaaacagaacattcatttaaaaattatgttagacctggtcccacacgtgcccaagaa
acatttggaaatagaacacgtcattcagttgaaactccagacatcaaagatttagccagc
actttaagtaaagaatctggtcaattgcccaacaaaaaaaattgcagaacgaatataagt
tatgggctagagaatgaacctacagcaacttatacaatgttttctgcttttcaggaaggt
agcaaaaaatcacaaacagattgcatattatctgatacatccccctctttcccctggtat
agacacgtttccaatgatagtaggaaaacagataaattaattggtttctccaaaccaatc
gtccgtaagaagctaagcttgagttcacagctaggatctttagagaagtttaagaggcaa
tatgggaaggttgaaaatcctctggatacagaagtagaggaaagtaatggagtcactacc
aatctcagtcttcaagttgaacctgacattctgctgaaggacaagaaccgcttagagaac
tctgatgtttgtaaaatcactactatggagcatagtgattcagatagtagttgtcaacca
gcaagccacatccttaactcagagaagtttccattctccaaggatgaagattgtttagaa
caacagatgcctagtttgagagaaagtcctatgaccctgaaggagttatctctctttaat
agaaaacctttggaccttgagaagtcatctgaatcactagcctctaaattatccagactg
aagggttccgaaagagaaactcaaacaatggggatgatgagtcgttttaatgaacttcca
aattcagattccagtaggaaagacagcaagttgtgcagtgtgttaacacaagatttttgt
atgttatttaacaacaagcatgaaaaaacagagaatggtgtcatcccaacatcagattct
gccacacaggataattcctttaataaaaatagtaaaacacattctaacagcaatacaaca
gagaactgtgtgatatcagaaactcctttggtattgccctataataattctaaagttacc
ggtaaagattcagatgttcttatcagagcctcagaacaacagataggaagtcttgactct
cccagtggaatgttaatgaatccggtagaagatgccacaggtgaccaaaatggaatttgt
tttcagagtgaggaatctaaagcaagagcttgttctgaaactgaagagtcaaacacgtgt
tgttcagattggcagcggcatttcgatgtagccctgggaagaatggtttatgtcaacaaa
atgactggactcagcacattcattgccccaactgaggacattcaggctgcttgtactaaa
gacctgacaactgtggctgtggatgttgtacttgagaatgggtctcagtacaggtgtcaa
ccttttagaagcgaccttgttcttcctttccttccgagagctcgagcagagaggactgtg
atgagacaggataacagagatactgtggatgatactgttagtagcgaatcgcttcagtct
ttgttctcagaatgggacaatccagtatttgcccgttatccagaggttgctgttgatgta
agcagtggccaggctgagagcttagcagttaaaattcacaacatcttgtatccctatcgt
ttcaccaaaggaatgattcattcaatgcaggttctccagcaagtagataacaagtttatt
gcctgtttgatgagcactaagactgaagagaatggcgaggcaggtgggaacctgctcgtg
ctggtggatcagcacgctgcccatgagcgtatacgtctggagcagcttatcattgattcc
tacgagaagcaacaggcacaaggctctggtcggaaaaaattactgtcttctactctaatt
cctccgctagagataacagtgacagaggaacaaaggagactcttatggtgttaccacaaa
aatctggaagatctgggccttgaatttgtatttccagacactagtgattctctggtcctt
gtgggaaaagtaccactatgttttgtggaaagagaagccaatgaacttcggagaggaaga
tctactgtgaccaagagtattgtggaggaatttatccgagaacaactggagctactccag
accaccggaggcatccaagggacattgccactgactgtccagaaggtgttggcatcccaa
gcctgccatggggccattaagtttaatgatggcctgagcttacaggaaagttgccgcctt
attgaagctctgtcctcatgccagctgccattccagtgtgctcacgggagaccttctatg
ctgccgttagctgacatagaccacttggaacaggaaaaacagattaaacccaacctcact
aaacttcgcaaaatggcccaggcctggcgtctctttggaaaagcagagtgtgatacaagg
cagagcctgcagcaatccatgcctccctgtgagccaccatga

DBGET integrated database retrieval system