KEGG   Homo sapiens (human): 27179
Entry
27179             CDS       T01001                                 
Symbol
IL36A, FIL1, FIL1(EPSILON), FIL1E, IL-1F6, IL1(EPSILON), IL1F6
Name
(RefSeq) interleukin 36 alpha
  KO
K05484  interleukin 36 alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    27179 (IL36A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    27179 (IL36A)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   27179 (IL36A)
SSDB
Motif
Pfam: IL1
Other DBs
NCBI-GeneID: 27179
NCBI-ProteinID: NP_055255
OMIM: 605509
HGNC: 15562
Ensembl: ENSG00000136694
Pharos: Q9UHA7(Tbio)
UniProt: Q9UHA7
Structure
LinkDB
Position
2:113005459..113011072
AA seq 158 aa
MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRG
NPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFES
VAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
NT seq 477 nt   +upstreamnt  +downstreamnt
atggaaaaagcattgaaaattgacacacctcagcaggggagcattcaggatatcaatcat
cgggtgtgggttcttcaggaccagacgctcatagcagtcccgaggaaggaccgtatgtct
ccagtcactattgccttaatctcatgccgacatgtggagacccttgagaaagacagaggg
aaccccatctacctgggcctgaatggactcaatctctgcctgatgtgtgctaaagtcggg
gaccagcccacactgcagctgaaggaaaaggatataatggatttgtacaaccaacccgag
cctgtgaagtcctttctcttctaccacagccagagtggcaggaactccaccttcgagtct
gtggctttccctggctggttcatcgctgtcagctctgaaggaggctgtcctctcatcctt
acccaagaactggggaaagccaacactactgactttgggttaactatgctgttttaa

DBGET integrated database retrieval system