KEGG   Homo sapiens (human): 27189
Entry
27189             CDS       T01001                                 
Symbol
IL17C, CX2, IL-17C
Name
(RefSeq) interleukin 17C
  KO
K05491  interleukin 17C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    27189 (IL17C)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    27189 (IL17C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    27189 (IL17C)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   27189 (IL17C)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 27189
NCBI-ProteinID: NP_037410
OMIM: 604628
HGNC: 5983
Ensembl: ENSG00000124391
Pharos: Q9P0M4(Tbio)
UniProt: Q9P0M4
LinkDB
Position
16:88638572..88640468
AA seq 197 aa
MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQ
ALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRY
PQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHT
EFIHVPVGCTCVLPRSV
NT seq 594 nt   +upstreamnt  +downstreamnt
atgacgctcctccccggcctcctgtttctgacctggctgcacacatgcctggcccaccat
gacccctccctcagggggcacccccacagtcacggtaccccacactgctactcggctgag
gaactgcccctcggccaggcccccccacacctgctggctcgaggtgccaagtgggggcag
gctttgcctgtagccctggtgtccagcctggaggcagcaagccacagggggaggcacgag
aggccctcagctacgacccagtgcccggtgctgcggccggaggaggtgttggaggcagac
acccaccagcgctccatctcaccctggagataccgtgtggacacggatgaggaccgctat
ccacagaagctggccttcgccgagtgcctgtgcagaggctgtatcgatgcacggacgggc
cgcgagacagctgcgctcaactccgtgcggctgctccagagcctgctggtgctgcgccgc
cggccctgctcccgcgacggctcggggctccccacacctggggcctttgccttccacacc
gagttcatccacgtccccgtcggctgcacctgcgtgctgccccgttcagtgtga

DBGET integrated database retrieval system