KEGG   Homo sapiens (human): 27235
Entry
27235             CDS       T01001                                 
Symbol
COQ2, CL640, COQ10D1, MSA1, PHB:PPT
Name
(RefSeq) coenzyme Q2, polyprenyltransferase
  KO
K06125  4-hydroxybenzoate polyprenyltransferase [EC:2.5.1.39]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00130  Ubiquinone and other terpenoid-quinone biosynthesis
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Module
hsa_M00128  Ubiquinone biosynthesis, eukaryotes, 4-hydroxybenzoate + polyprenyl-PP => ubiquinol
Disease
H00999  Coenzyme Q10 deficiency
H01614  Multiple system atrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    27235 (COQ2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:hsa01006]
    27235 (COQ2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.39  4-hydroxybenzoate polyprenyltransferase
     27235 (COQ2)
Prenyltransferases [BR:hsa01006]
 Compound prenylation
  4HB prenyltransferase
   27235 (COQ2)
SSDB
Motif
Pfam: UbiA
Other DBs
NCBI-GeneID: 27235
NCBI-ProteinID: NP_001345850
OMIM: 609825
HGNC: 25223
Ensembl: ENSG00000173085
Vega: OTTHUMG00000160940
Pharos: Q96H96(Tbio)
LinkDB
Position
4:complement(83263824..83285134)
AA seq 371 aa
MLGSRAAGFARGLRAVALAWLPGWRGRSFALARAAGAPHGGDLQPPACPEPRGRQLSLSA
AAVVDSAPRPLQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEPGCFPDWYMLSLFGTGAI
LMRGAGCTINDMWDQDYDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYY
SIALGAGSLLLVITYPLMKRISYWPQLALGLTFNWGALLGWSAIKGSCDPSVCLPLYFSG
VMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAMLGALSLVGVNSGQT
APYYAALGAVGAHLTHQIYTLDIHRPEDCWNKFISNRTLGLIVFLGIVLGNLWKEKKTDK
TKKGIENKIEN
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgctgggctcgcgagccgcggggttcgcgcggggcctgcgggctgtggcactggcgtgg
ctgccgggctggcggggccgctccttcgccctggcgcgtgcggcaggcgcgccccacggt
ggtgacttgcagccccccgcctgtcccgagccgcgcgggcgccagctcagtttgtccgcg
gcggcggtggtggactctgcgccccgccccctgcagccgtacttgcgcctcatgcggttg
gacaagcccattggaacctggcttctgtatttaccatgtacctggagcattggtttggca
gctgaaccaggttgttttccagattggtacatgctctccctctttggcactggagctatt
ctgatgcgtggagcaggctgtactattaatgacatgtgggaccaggactatgataaaaag
gttacaagaacagccaatcgtccaatagccgctggagacatttcaacttttcagtccttt
gtttttcttgggggacagctaaccctggcactgggtgttcttctgtgtctaaattactac
agtatagctctgggagcaggatccttacttcttgtcatcacctacccactaatgaaaaga
atttcatactggcctcaactagccttgggcttgacatttaattggggagcgttacttgga
tggtctgctatcaagggttcctgtgatccatctgtttgcctgcctctttatttttctgga
gttatgtggacactaatatatgatactatttatgcccatcaggacaaaagagatgatgtt
ttgattggtcttaagtcaacggctctgcggttcggagaaaataccaagccgtggctcagc
ggcttcagtgttgcaatgctgggggcactgagcctagtgggtgtgaacagtggacagact
gctccctactacgctgccctgggtgctgtaggagcccatctgactcaccagatttacact
ctagacatccacagacctgaggattgttggaataaatttatctccaaccgaacactggga
ctaatagtttttttagggattgtccttgggaatttgtggaaagaaaagaagacagacaaa
acaaagaagggtatagagaataaaatagaaaattaa

DBGET integrated database retrieval system