KEGG   Homo sapiens (human): 27346
Entry
27346             CDS       T01001                                 
Symbol
TMEM97, MAC30, sigma2R
Name
(RefSeq) transmembrane protein 97
  KO
K26171  sigma intracellular receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    27346 (TMEM97)
SSDB
Motif
Pfam: EBP
Other DBs
NCBI-GeneID: 27346
NCBI-ProteinID: NP_055388
OMIM: 612912
HGNC: 28106
Ensembl: ENSG00000109084
Pharos: Q5BJF2(Tbio)
UniProt: Q5BJF2
LinkDB
Position
17:28319200..28328685
AA seq 176 aa
MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQ
EPPAWFKSFLFCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLF
EDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK
NT seq 531 nt   +upstreamnt  +downstreamnt
atgggggctccggcaaccaggcgctgcgtggagtggctgctgggcctctacttcctcagc
cacatccccatcaccctgttcatggacctgcaggcggtgctgccgcgcgagctctaccca
gtcgagtttagaaacctgctgaagtggtatgctaaggagttcaaagacccactgctacag
gagcccccagcctggtttaagtcctttctgttttgcgagcttgtgtttcagctgcctttc
tttcccattgcaacgtatgccttcctcaaaggaagctgcaagtggattcgaactcctgca
atcatctactctgttcacaccatgacaaccttaattccgatactctccacatttctgttt
gaggatttctccaaagccagtggtttcaagggacaaagacctgagactttgcatgaacgg
ttaacccttgtgtctgtctatgccccctacttactcatcccattcatacttttaattttc
atgttgcggagcccctactacaagtatgaagagaaaagaaaaaaaaaatga

DBGET integrated database retrieval system