KEGG   Homo sapiens (human): 2766
Entry
2766              CDS       T01001                                 
Symbol
GMPR, GMPR_1, GMPR1
Name
(RefSeq) guanosine monophosphate reductase
  KO
K00364  GMP reductase [EC:1.7.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    2766 (GMPR)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.7  GMP reductase
     2766 (GMPR)
SSDB
Motif
Pfam: IMPDH FMN_dh Aldolase QRPTase_C Glu_synthase
Other DBs
NCBI-GeneID: 2766
NCBI-ProteinID: NP_006868
OMIM: 139265
HGNC: 4376
Ensembl: ENSG00000137198
Vega: OTTHUMG00000014302
Pharos: P36959(Tbio)
UniProt: P36959
Structure
LinkDB
Position
6:16238587..16295549
AA seq 345 aa
MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGT
FEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAV
PQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGV
GPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVM
LGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGD
VENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgccccgcatagatgcggacctcaagctcgacttcaaggatgtcctgctccgacctaag
cggagcagcctcaagagccgagccgaggtggatcttgaacgcaccttcacgtttcgaaat
tcaaagcagacctactcagggattcccatcatcgtggccaacatggacactgtgggcacg
tttgagatggcagccgtgatgtcacagcactccatgtttacagcaattcataagcattac
tccctggatgactggaagctctttgccacaaatcacccagaatgcctgcagaatgtagcc
gtgagttcaggcagtgggcagaatgatctggaaaagatgaccagcatcctggaagctgtg
ccacaggttaagtttatttgcctggatgtggccaatgggtattcagaacattttgtggaa
ttcgtgaaacttgtccgtgccaaatttcctgaacacaccattatggcagggaacgtggtg
acaggagaaatggtagaagagcttattctttccggagcagatatcatcaaagtgggagtt
ggaccaggttctgtgtgcaccacccgcaccaagacgggagtggggtacccccagctgagt
gccgtcattgagtgtgccgactctgcccatggcctgaagggccacatcatctctgatgga
ggctgtacgtgtccaggggatgtcgccaaagcctttggagctggagcagattttgtcatg
ctgggaggaatgttttcgggtcatacggagtgtgctggagaagtgtttgagaggaacgga
cggaagctcaagctcttctacgggatgagctctgacaccgccatgaacaagcacgcagga
ggagttgctgagtacagagcctctgagggtaagactgtggaagttccttacaaaggagat
gtggaaaacactatcctggatattctcgggggactgaggtccacgtgcacctacgtgggg
gccgccaaactcaaggagctcagcaggagggcaacattcatccgggtgacccagcagcac
aacaccgtgttcagctaa

KEGG   Homo sapiens (human): 51292
Entry
51292             CDS       T01001                                 
Symbol
GMPR2, GMPR_2
Name
(RefSeq) guanosine monophosphate reductase 2
  KO
K00364  GMP reductase [EC:1.7.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    51292 (GMPR2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.7  GMP reductase
     51292 (GMPR2)
SSDB
Motif
Pfam: IMPDH FMN_dh Aldolase Glu_synthase QRPTase_C
Other DBs
NCBI-GeneID: 51292
NCBI-ProteinID: NP_001002000
OMIM: 610781
HGNC: 4377
Ensembl: ENSG00000100938
Vega: OTTHUMG00000171912
Pharos: Q9P2T1(Tbio)
UniProt: Q9P2T1
Structure
LinkDB
Position
14:24232622..24239242
AA seq 348 aa
MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGT
FEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAI
PQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGI
GPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVM
LGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGD
VEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgcctcatattgacaacgatgtgaaactggacttcaaggatgtccttttgaggcccaaa
cgcagtacccttaagtctcgaagtgaggtggatctcacaagatccttttcatttcggaac
tcaaagcagacatactctggggttcccatcattgctgccaatatggatactgtgggcacc
tttgagatggccaaggttctctgtaagttctctctcttcactgctgtccataagcactat
agcctcgttcagtggcaagagtttgctggccagaatcctgactgtcttgagcatctggct
gccagctcaggcacaggctcttctgactttgagcagctggaacagatcctggaagctatt
ccccaggtgaagtatatatgcctggatgtggcaaatggctactctgaacactttgttgaa
tttgtaaaagatgtacggaagcgcttcccccagcacaccatcatggcagggaatgtggta
acaggagagatggtagaagagctcatcctttctggggctgacatcatcaaagtgggaatt
gggccaggctctgtgtgtactactcggaagaaaactggagtggggtatccacagctcagc
gcagtgatggagtgtgcagatgctgctcatggcctcaaaggccacatcatttcagatgga
ggttgcagctgtcctggggatgtggccaaggcttttggggcaggagctgacttcgtgatg
ctgggtggcatgctggctgggcacagtgagtcaggtggtgagctcatcgagagggatggc
aagaagtacaagctcttctatggaatgagttctgaaatggccatgaagaagtatgctggg
ggcgtggctgagtacagagcctcagagggaaagacagtggaagttccttttaaaggagat
gtggaacataccatccgagacatcctaggagggatccgctctacgtgtacctatgtggga
gcagctaagctcaaagagttgagcaggagaactaccttcatccgagtcacccagcaggtg
aatccaatcttcagtgaggcgtgctag

DBGET integrated database retrieval system