KEGG   Homo sapiens (human): 279
Entry
279               CDS       T01001                                 

Gene name
AMY2A, AMY2, PA
Definition
(RefSeq) amylase alpha 2A
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
hsa04970  Salivary secretion
hsa04972  Pancreatic secretion
hsa04973  Carbohydrate digestion and absorption
Network
nt06017  Glycogen metabolism
  Element
N00720  Glycogen degradation (amylase)
N00747  GAA deficiency in glycogen degradation
Drug target
Acarbose: D00216<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    279 (AMY2A)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    279 (AMY2A)
   04972 Pancreatic secretion
    279 (AMY2A)
   04973 Carbohydrate digestion and absorption
    279 (AMY2A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     279 (AMY2A)
SSDB
Motif
Pfam: Alpha-amylase_C Alpha-amylase DUF3078
Other DBs
NCBI-GeneID: 279
NCBI-ProteinID: NP_000690
OMIM: 104650
HGNC: 477
Ensembl: ENSG00000243480
Vega: OTTHUMG00000011023
Pharos: P04746(Tclin)
UniProt: P04746 Q53F26
LinkDB
Structure
PDB: 

Position
1p21.1
AA seq 511 aa
MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
NENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGN
AVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGL
LDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAG
SKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
FVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP
RQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQP
FTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGI
KIYVSDDGKAHFSISNSAEDPFIAIHAESKL
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgaagttctttctgttgcttttcaccattgggttctgctgggctcagtattccccaaat
acacaacaaggacggacatctattgttcatctgtttgaatggcgatgggttgatattgct
cttgaatgtgagcgatatttagctccgaagggatttggaggggttcaggtctctccacca
aatgaaaatgttgcaatttacaaccctttcagaccttggtgggaaagataccaaccagtt
agctataaattatgcacaagatctggaaatgaagatgaatttagaaacatggtgactaga
tgtaacaatgttggggttcgtatttatgtggatgctgtaattaatcatatgtgtggtaac
gctgtgagtgcaggaacaagcagtacctgtggaagttacttcaaccctggaagtagggac
tttccagcagtcccatattctggatgggatttcaatgatggtaaatgtaaaactggaagt
ggagatatcgagaactacaatgatgctactcaggtcagagattgtcgtctgactggtctt
cttgatcttgcactggagaaggattacgtgcgttctaagattgccgaatatatgaaccat
ctcattgacattggtgttgcagggttcagacttgatgcttccaagcacatgtggcctgga
gacataaaggcaattttggacaaactgcataatctaaacagtaactggttccctgcagga
agtaaacctttcatttaccaggaggtaattgatctgggtggtgagccaattaaaagcagt
gactactttggtaatggccgggtgacagaattcaagtatggtgcaaaactcggcacagtt
attcgcaagtggaatggagagaagatgtcttacttaaagaactggggagaaggttggggt
ttcgtaccttctgacagagcgcttgtctttgtggataaccatgacaatcaacgaggacat
ggggctggaggagcctctattcttaccttctgggatgctaggctgtacaaaatggcagtt
ggatttatgcttgctcatccttacggatttacacgagtaatgtcaagctaccgttggcca
agacagtttcaaaatggaaacgatgttaatgattgggttgggccaccaaataataatgga
gtaattaaagaagttactattaatccagacactacttgtggcaatgactgggtctgtgaa
catcgatggcgccaaataaggaacatggttattttccgcaatgtagtggatggccagcct
tttacaaattggtatgataatgggagcaaccaagtggcttttgggagaggaaacagagga
ttcattgttttcaacaatgatgactggtcattttctttaactttgcaaactggtcttcct
gctggcacatactgtgatgtcatttctggagataaaattaatggcaattgcacaggcatt
aaaatttacgtttctgatgatggcaaagctcatttttctattagtaactctgctgaagat
ccatttattgcaattcatgctgaatctaaattgtaa

DBGET integrated database retrieval system