KEGG   Homo sapiens (human): 2799
Entry
2799              CDS       T01001                                 
Symbol
GNS, G6S
Name
(RefSeq) glucosamine (N-acetyl)-6-sulfatase
  KO
K01137  N-acetylglucosamine-6-sulfatase [EC:3.1.6.14]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00531  Glycosaminoglycan degradation
hsa01100  Metabolic pathways
hsa04142  Lysosome
Module
hsa_M00078  Heparan sulfate degradation
hsa_M00079  Keratan sulfate degradation
Network
nt06012  Glycosaminoglycan degradation
  Element
N00615  Heparan sulfate degradation
N00623  Keratan sulfate degradation
Disease
H00130  Mucopolysaccharidosis type III
H00421  Mucopolysaccharidosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    2799 (GNS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    2799 (GNS)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.14  N-acetylglucosamine-6-sulfatase
     2799 (GNS)
SSDB
Motif
Pfam: Sulfatase Phosphodiest
Other DBs
NCBI-GeneID: 2799
NCBI-ProteinID: NP_002067
OMIM: 607664
HGNC: 4422
Ensembl: ENSG00000135677
Pharos: P15586(Tbio)
UniProt: P15586 A0A024RBC5 Q7Z3X3
LinkDB
Position
12:complement(64713449..64759406)
AA seq 552 aa
MRLLPLAPGRLRRGSPRHLPSCSPALLLLVLGGCLGVFGVAAGTRRPNVVLLLTDDQDEV
LGGMTPLKKTKALIGEMGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSS
KSWQKIQEPNTFPAILRSMCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSK
YYNYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTA
APQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTLLSVD
DLVEKLVKRLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIK
PNQTSKMLVANIDLGPTILDIAGYDLNKTQMDGMSLLPILRGASNLTWRSDVLVEYQGEG
RNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYN
LTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRG
SVRTRRFSKHLL
NT seq 1659 nt   +upstreamnt  +downstreamnt
atgcggctcctgcctctagccccaggtcggctccggcggggcagcccccgccacctgccc
tcctgcagcccagcgctgctactgctggtgctgggcggctgcctgggggtcttcggggtg
gctgcgggaacccggaggcccaacgtggtgctgctcctcacggacgaccaggacgaagtg
ctcggcggcatgacaccgctaaagaaaaccaaagctctcatcggagagatggggatgact
ttttccagtgcttatgtgccaagtgctctctgctgccccagcagagccagtatcctgaca
ggaaagtacccacataatcatcacgttgtgaacaacactctggaggggaactgcagtagt
aagtcctggcagaagatccaagaaccaaatactttcccagcaattctcagatcaatgtgt
ggttatcagaccttttttgcagggaaatatttaaatgagtacggagccccagatgcaggt
ggactagaacacgttcctctgggttggagttactggtatgccttggaaaagaattctaag
tattataattacaccctgtctatcaatgggaaggcacggaagcatggtgaaaactatagt
gtggactacctgacagatgttttggctaatgtctccttggactttctggactacaagtcc
aactttgagcccttcttcatgatgatcgccactccagcgcctcattcgccttggacagct
gcacctcagtaccagaaggctttccagaatgtctttgcaccaagaaacaagaacttcaac
atccatggaacgaacaagcactggttaattaggcaagccaagactccaatgactaattct
tcaatacagtttttagataatgcatttaggaaaaggtggcaaactctcctctcagttgat
gaccttgtggagaaactggtcaagaggctggagttcactggggagctcaacaacacttac
atcttctatacctcagacaatggctatcacacaggacagttttccttgccaatagacaag
agacagctgtatgagtttgatatcaaagttccactgttggttcgaggacctgggatcaaa
ccaaatcagacaagcaagatgctggttgccaacattgacttgggtcctactattttggac
attgctggctacgacctaaataagacacagatggatgggatgtccttattgcccattttg
agaggtgccagtaacttgacctggcgatcagatgtcctggtggaataccaaggagaaggc
cgtaacgtcactgacccaacatgcccttccctgagtcctggcgtatctcaatgcttccca
gactgtgtatgtgaagatgcttataacaatacctatgcctgtgtgaggacaatgtcagca
ttgtggaatttgcagtattgcgagtttgatgaccaggaggtgtttgtagaagtctataat
ctgactgcagacccagaccagatcactaacattgctaaaaccatagacccagagctttta
ggaaagatgaactatcggttaatgatgttacagtcctgttctgggccaacctgtcgcact
ccaggggtttttgaccccggatacaggtttgacccccgtctcatgttcagcaatcgcggc
agtgtcaggactcgaagattttccaaacatcttctgtag

DBGET integrated database retrieval system