KEGG   Homo sapiens (human): 284340
Entry
284340            CDS       T01001                                 
Symbol
CXCL17, DMC, Dcip1, UNQ473, VCC-1, VCC1
Name
(RefSeq) C-X-C motif chemokine ligand 17
  KO
K22627  C-X-C motif chemokine 17
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    284340 (CXCL17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    284340 (CXCL17)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   284340 (CXCL17)
SSDB
Motif
Pfam: CXCL17
Other DBs
NCBI-GeneID: 284340
NCBI-ProteinID: NP_940879
OMIM: 611387
HGNC: 19232
Ensembl: ENSG00000189377
Pharos: Q6UXB2(Tbio)
UniProt: Q6UXB2
LinkDB
Position
19:complement(42428278..42442946)
AA seq 119 aa
MKVLISSLLLLLPLMLMSMVSSSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAP
RRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL
NT seq 360 nt   +upstreamnt  +downstreamnt
atgaaagttctaatctcttccctcctcctgttgctgccactaatgctgatgtccatggtc
tctagcagcctgaatccaggggtcgccagaggccacagggaccgaggccaggcttctagg
agatggctccaggaaggcggccaagaatgtgagtgcaaagattggttcctgagagccccg
agaagaaaattcatgacagtgtctgggctgccaaagaagcagtgcccctgtgatcatttc
aagggcaatgtgaagaaaacaagacaccaaaggcaccacagaaagccaaacaagcattcc
agagcctgccagcaatttctcaaacaatgtcagctaagaagctttgctctgcctttgtag

DBGET integrated database retrieval system