KEGG   Homo sapiens (human): 28972
Entry
28972             CDS       T01001                                 

Gene name
SPCS1, HSPC033, SPC1, SPC12, YJR010C-A
Definition
(RefSeq) signal peptidase complex subunit 1
  KO
K12946  signal peptidase complex subunit 1 [EC:3.4.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    28972 (SPCS1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     28972 (SPCS1)
SSDB
Motif
Pfam: SPC12 MFS_1 DUF1440 7TM_GPCR_Sri
Other DBs
NCBI-GeneID: 28972
NCBI-ProteinID: NP_054760
OMIM: 610358
HGNC: 23401
Ensembl: ENSG00000114902
Vega: OTTHUMG00000154930
Pharos: Q9Y6A9(Tdark)
UniProt: Q9Y6A9
LinkDB
Position
3p21.1
AA seq 102 aa
MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSC
LLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAKNN
NT seq 309 nt   +upstreamnt  +downstreamnt
atgctggagcatctgagctcgctgcccacgcagatggattacaagggccagaagctagct
gaacagatgtttcagggaattattcttttttctgcaatagttggatttatctacgggtac
gtggctgaacagttcgggtggactgtctatatagttatggccggatttgctttttcatgt
ttgctgacacttcctccatggcccatctatcgccggcatcctctcaagtggttacctgtt
caagaatcaagcacagacgacaagaaaccaggggaaagaaaaattaagaggcatgctaaa
aataattga

DBGET integrated database retrieval system