KEGG   Homo sapiens (human): 28984
Entry
28984             CDS       T01001                                 
Symbol
RGCC, C13orf15, RGC-32, RGC32, bA157L14.2
Name
(RefSeq) regulator of cell cycle
  KO
K26108  regulator of cell cycle RGCC
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    28984 (RGCC)
SSDB
Motif
Pfam: RGCC
Other DBs
NCBI-GeneID: 28984
NCBI-ProteinID: NP_054778
OMIM: 610077
HGNC: 20369
Ensembl: ENSG00000102760
Pharos: Q9H4X1(Tbio)
UniProt: Q9H4X1
LinkDB
Position
13:41457550..41470871
AA seq 137 aa
MKPPAAQGSPAAAAAAAPALDSAAAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERM
KRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDT
KELEAFIADLDKTLASM
NT seq 414 nt   +upstreamnt  +downstreamnt
atgaagccgcccgcggcgcagggcagccccgcggccgccgcggccgcagccccggccctg
gactcggcggccgcggaggacctgtcggacgcgctgtgcgagtttgacgcggtgctggcc
gacttcgcgtcgcccttccacgagcgccacttccactacgaggagcacctggagcgcatg
aagcggcgcagcagcgccagtgtcagcgacagcagcggcttcagcgactcggagagtgca
gattcactttataggaacagcttcagcttcagtgatgaaaaactgaattctccaacagac
tctaccccagctcttctctctgccactgtcactcctcagaaagctaaattaggagacaca
aaagagctagaagccttcattgctgatcttgacaaaactttagcaagtatgtga

DBGET integrated database retrieval system