KEGG   Homo sapiens (human): 2936
Entry
2936              CDS       T01001                                 
Symbol
GSR, GR, GSRD, HEL-75, HEL-S-122m
Name
(RefSeq) glutathione-disulfide reductase
  KO
K00383  glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
hsa04918  Thyroid hormone synthesis
hsa05415  Diabetic cardiomyopathy
Network
nt06026  Glutathione biosynthesis
  Element
N00904  Glutathione reduction
Disease
H00668  Anemia due to disorders of glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2936 (GSR)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    2936 (GSR)
 09160 Human Diseases
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    2936 (GSR)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.7  glutathione-disulfide reductase
     2936 (GSR)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored FAD_binding_2 AlaDh_PNT_C GIDA HI0933_like NAD_binding_8 DAO FAD_binding_3
Other DBs
NCBI-GeneID: 2936
NCBI-ProteinID: NP_000628
OMIM: 138300
HGNC: 4623
Ensembl: ENSG00000104687
Pharos: P00390(Tclin)
UniProt: P00390 V9HW90
Structure
LinkDB
Position
8:complement(30678066..30727846)
AA seq 522 aa
MALLPRALSAGAGPSWRRAARAFRGFLLLLPEPAALTRALSRAMACRQEPQPQGPPPAAG
AVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHS
EFMHDHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDP
KPTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELPGRSVIVGAG
YIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKK
TLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVD
EFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPP
IGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQ
GLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
NT seq 1569 nt   +upstreamnt  +downstreamnt
atggccctgctgccccgagccctgagcgccggcgcgggaccgagctggcggcgggcggcg
cgcgccttccgaggcttcctgctgcttctgcccgagcccgcggccctcacgcgcgccctc
tcccgtgccatggcctgcaggcaggagccgcagccgcagggcccgccgcccgctgctggc
gccgtggcctcctatgactacctggtgatcgggggcggctcgggcgggctggccagcgcg
cgcagggcggccgagctgggtgccagggccgccgtggtggagagccacaagctgggtggc
acttgcgtgaatgttggatgtgtacccaaaaaggtaatgtggaacacagctgtccactct
gaattcatgcatgatcatgctgattatggctttccaagttgtgagggtaaattcaattgg
cgtgttattaaggaaaagcgggatgcctatgtgagccgcctgaatgccatctatcaaaac
aatctcaccaagtcccatatagaaatcatccgtggccatgcagccttcacgagtgatccc
aagcccacaatagaggtcagtgggaaaaagtacaccgccccacacatcctgatcgccaca
ggtggtatgccctccacccctcatgagagccagatccccggtgccagcttaggaataacc
agcgatggattttttcagctggaagaattgcccggccgcagcgtcattgttggtgcaggt
tacattgctgtggagatggcagggatcctgtcagccctgggttctaagacatcactgatg
atacggcatgataaggtacttagaagttttgattcaatgatcagcaccaactgcacggag
gagctggagaacgctggcgtggaggtgctgaagttctcccaggtcaaggaggttaaaaag
actttgtcgggcttggaagtcagcatggttactgcagttcccggtaggctaccagtcatg
accatgattccagatgttgactgcctgctctgggccattgggcgggtcccgaataccaag
gacctgagtttaaacaaactggggattcaaaccgatgacaagggtcatatcatcgtagac
gaattccagaataccaacgtcaaaggcatctatgcagttggggatgtatgtggaaaagct
cttcttactccagttgcaatagctgctggccgaaaacttgcccatcgactttttgaatat
aaggaagattccaaattagattataacaacatcccaactgtggtcttcagccacccccct
attgggacagtgggactcacggaagatgaagccattcataaatatggaatagaaaatgtg
aagacctattcaacgagctttaccccgatgtatcacgcagttaccaaaaggaaaacaaaa
tgtgtgatgaaaatggtctgtgctaacaaggaagaaaaggtggttgggatccatatgcag
ggacttgggtgtgatgaaatgctgcagggttttgctgttgcagtgaagatgggagcaacg
aaggcagactttgacaacacagtcgccattcaccctacctcttcagaagagctggtcaca
cttcgttga

DBGET integrated database retrieval system